KEGG   Pectobacterium parmentieri WPP163: Pecwa_4442Help
Entry
Pecwa_4442        CDS       T01106                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pwa  Pectobacterium parmentieri WPP163
Brite
Enzymes [BR:pwa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Pecwa_4442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACX90134
UniProt: D0KDB8
LinkDB All DBs
Position
4866558..4867184
Genome map
AA seq 208 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKETMEIHHSKHHQAYVNNANAALESLPELAKLSVEELIAQ
LDKVPAEKKAALRNNAGGHANHSLFWKGLKLGTTLAGDLKAAIERDFGSVDAFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAISGTSGYPIVGLDVWEHAYYLKFQ
NRRPDYAKAFWNVLNWDEAAARFAGAKK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatcgctgccttatgcttatgacgcactggaaccgcatttcgac
aaagaaacgatggaaattcaccattccaaacaccatcaggcttacgtcaataatgctaat
gccgcgctggaatccctgcctgagctggctaaattatcggttgaagagctgattgctcaa
ctggataaggtccctgccgagaaaaaagcagcactgcgtaacaacgctggcggccacgct
aaccacagcctgttttggaaaggcctgaaattaggcactacgctggctggcgatctgaaa
gcagcaatcgaacgcgatttcggcagcgttgatgcgtttaaagagaaatttgagcaagca
gcagcaacccgctttggctctggctgggcttggctggttctgaaagacgacggcaagctg
gctgtggtttctaccgcaaaccaagacagtccgctgatgggtgaagcgatttctggtacc
tctggctacccaatcgtcggtctggacgtatgggaacacgcttactacctgaaattccaa
aaccgtcgcccagattacgctaaagcattctggaacgtgctgaactgggacgaagctgcg
gctcgcttcgctggcgcgaaaaaataa

DBGET integrated database retrieval system