KEGG   Candidatus Wolfebacteria bacterium GW2011_GWB1_47_1: UX70_C0001G0074Help
Entry
UX70_C0001G0074   CDS       T04023                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pwo  Candidatus Wolfebacteria bacterium GW2011_GWB1_47_1
Brite
KEGG Orthology (KO) [BR:pwo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    UX70_C0001G0074
Enzymes [BR:pwo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     UX70_C0001G0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_oxidored NAD_binding_8 FAD_binding_2 HI0933_like Thi4 GIDA NAD_binding_7 DAO K_oxygenase AlaDh_PNT_C Lycopene_cycl Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: AKM77812
UniProt: A0A0G4ASU3
LinkDB All DBs
Position
complement(63001..63924)
Genome map
AA seq 307 aa AA seqDB search
MYDLIIIGGGPAGVAAGVYASRKKLNALLLTKDFGGQAITSAKIENFIGHIAISGLELAQ
VLETQLRAQKHIVITDGITVERVTKIDGGFSVVDSKGRVYDTKTILVTLGSIYRHLNIPG
ERAFSGKGVFYCATCDAPLMQDKAVVVIGGGNSGLEAARDLLPFASHITILEFAPMLKGD
MTTQELLRSDPKITIVTQAQTKEIVGDTFVRGLTYVDRTTNEEKNLAVEGVFVAIGMQPN
SGIVSDLVDITPNGNIIVDKTTFQSSLKGIWAAGDITDASYNQINTAIGEAIKAVLNISE
ALAKKEL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatctcattattattgggggtgggcctgcgggtgttgcagcgggtgtgtacgca
tcccggaaaaaattgaatgcattgctactgaccaaggatttcggcgggcaggcgattact
tcggcaaagatcgaaaactttatcggtcacatcgctatttccggattggaactcgctcag
gtgcttgaaacccaacttcgtgcccagaaacacatcgtaatcacggatggcataaccgtt
gagcgtgtaacaaagattgacggaggattttcagttgttgattcaaaagggcgggtctat
gataccaaaacaatattggtgacattagggagtatctatagacatttgaatatacccggg
gaacgtgcgttttccggcaagggtgttttttactgcgcgacgtgcgatgcaccgttgatg
caggataaggccgttgtggtcattggtggagggaatagcggacttgaggcggcacgtgac
ttattgcccttcgcttcgcacattaccatcctggaatttgctccaatgttaaagggagac
atgactactcaagagttattgcgcagcgacccgaaaataacgattgttacgcaggcgcaa
acgaaggaaatcgttggggatacatttgtgcgcggattgacatatgtcgatcgcacgact
aacgaagaaaagaaccttgctgttgagggcgtgtttgttgctattggtatgcagcccaac
tcgggtattgttagtgatcttgtcgatattacaccgaacggaaacattatcgtcgataag
acgacattccaatcatcactcaagggcatttgggctgcgggggatattaccgacgcttca
tacaaccagattaatacggctatcggagaggcgattaaagccgtactaaacatctctgaa
gcgttggcaaaaaaagaattatga

DBGET integrated database retrieval system