KEGG   Pectobacterium wasabiae: A7983_03915Help
Entry
A7983_03915       CDS       T04535                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
pws  Pectobacterium wasabiae
Pathway
pws00471  D-Glutamine and D-glutamate metabolism
pws00550  Peptidoglycan biosynthesis
pws01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pws00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    A7983_03915
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A7983_03915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pws01011]
    A7983_03915
Enzymes [BR:pws01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     A7983_03915
Peptidoglycan biosynthesis and degradation proteins [BR:pws01011]
 Precursor biosynthesis
  Amino acid ligase
   A7983_03915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: AOR62428
UniProt: A0A1D7YXQ7
LinkDB All DBs
Position
complement(880509..881969)
Genome map
AA seq 486 aa AA seqDB search
MNTQQLAKLRSIVPEMHRVRHIHFVGIGGAGMGGIAEVLANEGYEISGSDLAPNAVTQQL
TELGAQIYFHHRAENVLNASVVVVSSAITADNPEIVAAHDARIPVIRRAEMLAELMRFRH
GIAIAGTHGKTTTTAMVTSIYAEAGLDPTFVNGGLVKAAGTHARLGSSRYLIAEADESDA
SFLHLQPMVAIVTNIEADHMDTYQGDFENLKQTFINFLHNLPFYGQAVMCVDDEVIRELL
PRVGRHIITYGFSDDADVRIAGYRQTGAQGHFTLERKDKPLLNVTLNAPGRHNALNAAAA
VAVATDEGIDDESILRALERFQGTGRRFDFLGEYPLELVNGHSGTAMLVDDYGHHPTEVD
ATIKAARAGWPDKRLVMIFQPHRYTRTRDLYDDFAHVLSQVDVLLMLDVYSAGESPIPGA
DSRSLCRTIRGRGKIDPILVTDVDTLPELLSQALRGEDLILVQGAGNIGKLARKLADSRL
QPQISE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtgaatactcaacaactggcgaaactacgttcaatcgtgcccgagatgcatcgcgtccgg
cacatacactttgtcggcatcggcggtgctggcatgggtggtatcgccgaagtgttggcc
aacgaaggttatgaaattagcggttccgatctggcaccgaatgcggtgacgcaacagttg
accgaacttggcgcgcagatttatttccaccaccgtgcagagaacgttctgaacgccagc
gtggtggtggtatcaagtgcgattacggcggataacccagagattgtcgctgcgcatgat
gcacggattccggtgatccgtcgtgccgaaatgttggcggaactgatgcgatttcgtcat
ggcattgcgatcgcgggtacgcatggcaagacgacgacaacggcgatggtcaccagtatt
tatgctgaagcgggattggacccaacgtttgtgaacggcggtttggtgaaagcagcggga
acgcatgcgcgtttgggctcaagccgttacctgatcgcagaagcagatgaaagcgatgcg
tccttcctgcatttgcagccgatggtggcgattgtaaccaacattgaagccgaccatatg
gacacctatcagggcgattttgagaacctgaagcagacgttcattaatttcctgcacaac
ctgccgttttatggtcaggccgtgatgtgtgtggatgatgaggtaatccgtgagctgctg
ccacgtgttggtcgtcacatcattacctatggttttagcgacgatgctgatgtgcgaatt
gctggatatcgtcagactggcgcacaagggcactttacgctggagcggaaagataaaccg
ttgctgaacgttacgctgaatgcgccggggcgtcacaatgcgctgaatgcagcggcggcg
gttgccgtggcgaccgatgaaggcatcgacgacgagtcgattctgcgcgcgctagaacgt
tttcagggcaccgggcgtcgctttgattttctcggcgagtatccgctcgaattagtcaat
ggacacagtggcaccgcgatgttggtcgatgattatggccatcatccgactgaggttgat
gctacgattaaagccgcacgcgctggctggccagataagcggttagttatgatttttcag
ccacatcgctatacgcgcacccgtgatttgtacgacgacttcgcgcatgtgctatcgcag
gttgacgtgttgctgatgctggatgtgtattccgctggagaatcgccgattccgggcgca
gacagccgttcactgtgccgtaccattcgcggaagaggtaagattgatccgattctggtg
acggatgtggatactttaccggaactgttgtcacaggcgctgcgaggtgaagacctgatc
ttggttcagggagccggcaacatcggtaaactggcgcgtaaactggctgattccagatta
cagccgcagataagtgaatga

DBGET integrated database retrieval system