KEGG   Pectobacterium wasabiae: A7983_04680Help
Entry
A7983_04680       CDS       T04535                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pws  Pectobacterium wasabiae
Brite
KEGG Orthology (KO) [BR:pws00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A7983_04680
Enzymes [BR:pws01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A7983_04680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Glutaredoxin DAO NAD_binding_8 Thi4 K_oxygenase DSBA Lycopene_cycl AlaDh_PNT_C NAD_binding_7 Antiterm FMO-like
Motif
Other DBs
NCBI-ProteinID: AOR62574
UniProt: A0A1D7YY53
LinkDB All DBs
Position
complement(1053115..1054677)
Genome map
AA seq 520 aa AA seqDB search
MLDNTMKVQLKAYLEKLTKPVELIATLDDSAKSAEVRTLLTEIAELSERVSFIEKNELAV
RKPSFLITNPDSQSGPRFAGAPMGHEFTSLILALLQVGGHPSKEAKELLDQIRNLDGSFH
FETYYSLSCHNCPDVVQALNLMVVLNPNITHTAIDGGAFQDEIQSRNVMGVPTVFLNGEH
FSQGRTSLAEIVTKIDTGAGAKQVEKLNQRDVYDVLIIGSGPAGAAAAVYSARKGIRTGL
VGERFGGQVLDTVDIENYISVPKTEGAKLATALKSHVDDYDVDVIDAQSAEALIPSNEPG
KPHQVITVSGATLKARSVIIATGARWRNMNVPGEEQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQEKVRSLPNVDIILNAQTTEVKGD
GQKVTGLSYKDRITDTVHDLPLEGIFVQIGLLPNTHWLEGTIARNRIGEIEIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTRA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaatacgatgaaagtccagttgaaagcctatctggaaaaattaaccaaacct
gttgagttgattgcgactctggatgactccgcgaaatctgctgaagtcagaaccttgctg
actgagatcgccgagctgtccgaacgggtgagtttcattgaaaagaatgagctagcagtc
cgtaagccttcattcctgattaccaatccagattcccaaagcggtccgcgttttgccggt
gcgccgatgggacatgaatttacctccctgattctggcgttattgcaggtgggtgggcat
ccgtcgaaagaagcgaaagaattactcgatcaaatccgtaaccttgacggttcattccac
tttgaaacgtattattcgctgtcctgccacaactgcccggacgtggtgcaggcgctgaat
ttaatggtggtgttgaacccaaatatcacccataccgcaattgacggcggcgcgttccag
gatgagattcaaagccgtaatgtcatgggcgttcccaccgttttcctgaacggcgaacac
ttcagccaagggcggacgagccttgctgaaattgtgactaaaattgatactggcgcaggt
gctaaacaggttgagaagctgaaccaacgtgacgtctatgatgtgttaattatcggtagc
ggcccggcaggagcggcagcggcggtctattcggcgcgtaaaggtattcgcaccgggttg
gtcggcgaacgctttggtggccaggtactggatactgttgatatcgaaaactacatttct
gtgccgaaaacggaaggcgcaaagctggcaaccgcgttgaaaagccatgttgatgactat
gatgtcgatgtgatcgatgcgcagagtgcagaggctttaatccctagtaacgaaccgggt
aaaccgcaccaggtgattaccgtatccggtgcgacgctgaaagcgcgtagtgtgatcatt
gcgactggcgcacgctggagaaacatgaatgtgcccggcgaagaacagtaccggacgcgt
ggcgtaacgtattgtccgcactgcgatggtccgctgtttaaaggcaagcacgttgcggtg
attggtggcggaaactctggcgtagaagcggctatcgatctggccggcgtggtgaaacat
gtcacactgcttgagtttgcaccggagctgaaagcggattcggtattgcaggagaaagtg
cgtagcctgccgaacgtcgacattattctgaatgcgcaaaccacagaagtgaaaggcgac
ggacagaaggtaacggggctgagctacaaagaccgtattactgatacggtacacgattta
ccgctggaagggatcttcgtgcaaatcggtctgttgcctaacactcactggctggaaggt
acgatcgccagaaaccgcattggtgaaattgagatcgatgccaagtgtgaaaccagcgtg
aaaggggtctttgctgctggtgactgtacgacggtgccgtacaaacagatcatcatcgcg
acgggcgaaggagcaaaagcgtccttgagcgcctttgattatctgattagaacgcgtgcg
tag

DBGET integrated database retrieval system