KEGG   Pectobacterium wasabiae: A7983_05780Help
Entry
A7983_05780       CDS       T04535                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pws  Pectobacterium wasabiae
Pathway
pws00564  Glycerophospholipid metabolism
pws01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pws00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A7983_05780
Enzymes [BR:pws01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A7983_05780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_2 NAD_binding_8 3HCDH_N FAD_binding_3 PAP_PilO FAD_oxidored GIDA HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AOR62784
UniProt: A0A1D7YYQ5
LinkDB All DBs
Position
1276700..1278202
Genome map
AA seq 500 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALSERETLLKMAPHIIFPMRFRLPHQPHLRPAWMIRIGLFMYDNIGKRVSLPAS
KGLKFGADSVLKPELKQGFEYSDCWVDDARLVVLNAQEVTKRGGEVRTRTKVTRARREQG
VWIVDAVDSLTGETFTWRAKGLVNATGPWVKEFFDDGLKLKSPYGIRLIKGSHIVVPKVH
NQPQAYILQNKDHRIVFVIPWQDDYSIIGTTDVEYKGNPHDVKIDDNEVGYLLDVYNDHF
KQQLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLSVDDDNGQAPLLSVFGGKLTTYRK
LAEHALDKLHKYYPQAGKAWTKGAVLPGGDIAGTRDDYAAALRRRFNLPESLTRRYSRTY
GSNSELILANVKNLSDLGEDFGHDLYEVELRYLVEKEWAVTLDDVIWRRTKLGMRFDDAQ
KQRISDWLASHHEQQMAKAG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctcatcgttatcggcggcggaattaacggtgcaggcatcgccgca
gatgcggctgggcggggtttatcagtcctgttgttggaagcacaggatcttgcctgtgcc
acgtcctccgccagctccaagctgattcacggtggcctgcgttaccttgagcactatgag
tttcgtttggtcagcgaagcgctgtctgagcgtgaaacgctgctgaaaatggccccgcac
attattttcccgatgcgctttcgtttgccccatcagccgcacctgcgtccagcctggatg
attcgcatcggcctgttcatgtatgacaacattggcaaacgcgtcagcctgcctgccagt
aagggactgaaattcggtgcagattccgttcttaaacctgaactgaagcaaggctttgaa
tattcggactgctgggtggacgatgcacgtctggtggtgttaaacgcgcaagaagtgaca
aaacgcggcggagaagtccgtactcgtaccaaagtgacccgcgctcgccgtgagcaaggc
gtgtggattgtcgatgcggttgattcactgaccggcgaaaccttcacctggcgcgccaaa
ggcctagtgaacgcgaccggcccgtgggtgaaagagttctttgatgacggcctaaaactg
aaatcgccttacggcatccgtttgatcaaaggcagccacatcgtggtgccaaaagtccac
aaccagccgcaggcgtatattctgcaaaacaaagatcaccgtattgtgttcgtgatcccg
tggcaggatgactactcgatcatcggcaccaccgacgtggaatacaaaggcaatccacac
gatgtgaagatcgatgacaacgaagtcggttacctgctggatgtgtataacgatcatttc
aaacagcagctcacgcgtgacgatatcgtctggacgtattccggcgtgcgtccgctgtgt
gatgacgaatccgattctccacaggcgattacgcgtgattacaccctgtcagtggatgat
gataacggtcaggctccactgctttccgtgtttggcggcaagctgacgacgtaccgtaag
ctggcagaacacgcgctggacaagttacacaagtattatccgcaggcaggaaaggcctgg
acgaaaggtgcggtactgccgggtggtgatattgctggtacgcgtgatgactacgccgcc
gcactgcgtcgtcgcttcaatctgcctgaatcactgacgcgccgttacagccgtacctac
ggttcaaacagtgaactgatcctggcaaacgtgaaaaacctcagcgatctgggtgaagat
ttcggtcatgacctgtatgaggtagaactgcgctatctggttgagaaagagtgggctgtc
acgctggacgacgtcatctggcgtcgtaccaaactgggcatgcgctttgatgacgcgcag
aaacagcgcatcagcgactggttagccagccaccacgaacagcagatggcaaaagcgggt
taa

DBGET integrated database retrieval system