KEGG   Pectobacterium wasabiae: A7983_08725Help
Entry
A7983_08725       CDS       T04535                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
pws  Pectobacterium wasabiae
Pathway
pws00260  Glycine, serine and threonine metabolism
pws01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pws00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A7983_08725
Enzymes [BR:pws01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     A7983_08725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AlaDh_PNT_C HI0933_like FAD_binding_2 Pyr_redox_2 ThiF Shikimate_DH FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AOR63340
UniProt: A0A1D7Z0D6
LinkDB All DBs
Position
1941277..1942308
Genome map
AA seq 343 aa AA seqDB search
MKALAKLRPEEGIWMMDAPTPELGHNDIMIKIRKSAICGTDVHIYNWDEWSQKTIPVPMV
VGHEYVGEIVAIGQEVNGFHIGDRVSGEGHITCGYCRNCRAGRRHLCRNAIGVGVNRPGS
FAEYLVIPAYNAFRIPDNISDELAAIFDPFGNAVHTALSFDLVGEDVLIAGAGPIGMMAA
AVCCHVGARNVVITDVNAYRLELASKMGATRAVNVAQENLADVMIELGMTEGFDIGLEMS
GAPSAFRAMLKAMNHGGRIAMLGIPHEPMSIDWGEVIFKGLFIKGIYGREMFETWYKMSA
LIQSGLDLSPIITHRFHIDEFQKGFDAMRSGQSGKVILNWDET
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattggcaaaattgcggccggaagaaggtatctggatgatggatgcccccacg
ccggagcttggacataacgatattatgattaaaatccgcaaaagcgcgatatgcggaacg
gatgtgcatatctataactgggatgagtggtcgcagaagactattccggttccgatggtt
gtcgggcatgagtacgtgggcgaaatcgttgctatcggtcaggaagttaacggttttcat
attggcgatcgggtttctggtgaggggcatattacctgtggctactgccgtaactgccgt
gccgggcggcgtcatttatgccgtaatgcgattggcgtcggggtaaaccgccccggttca
ttcgcggagtatctggtgatccctgcctacaacgcgtttcgcattcccgacaatatttct
gatgagctggccgccattttcgatcccttcggcaacgcggtgcataccgcactgtccttc
gatttagtgggggaagatgtgttgattgccggagcggggccgattggcatgatggcggcg
gcggtgtgctgtcacgttggtgcaaggaatgtcgtgattaccgatgtgaatgcgtatcgt
ctggagttggctagtaaaatgggggcaacgcgcgccgtcaatgtggctcaggaaaatctg
gctgatgtgatgatagaactgggcatgaccgaggggtttgatattgggttggagatgtcg
ggcgcgccatcggcttttcgtgcgatgttgaaagcgatgaatcacggtgggcgtatcgcc
atgctgggtattccgcacgaaccaatgtcgattgactggggagaggtgatttttaaaggg
ctgttcatcaaagggatctacggacgggaaatgttcgaaacctggtacaaaatgtcggca
ctgattcagtctgggctggatttgtccccgattatcacccaccgctttcatattgatgag
tttcagaaagggttcgatgccatgcgctcgggtcaatcgggcaaggtgattctcaattgg
gatgagacataa

DBGET integrated database retrieval system