KEGG   Pectobacterium wasabiae: A7983_08805Help
Entry
A7983_08805       CDS       T04535                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pws  Pectobacterium wasabiae
Pathway
pws00620  Pyruvate metabolism
pws00680  Methane metabolism
pws01100  Metabolic pathways
pws01120  Microbial metabolism in diverse environments
pws01200  Carbon metabolism
Module
pws_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pws00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A7983_08805
  09102 Energy metabolism
   00680 Methane metabolism
    A7983_08805
Enzymes [BR:pws01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A7983_08805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOR63356
UniProt: A0A1D7Z0R6
LinkDB All DBs
Position
complement(1961230..1963869)
Genome map
AA seq 879 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKEALGENILDKVETIRKLSKSSRAGNEKHRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHTISPHGEAASNPAQLSNAFERLKENKDLTER
DIRDAVESLSIELVLTAHPTEITRRTLIHKLVEVNTCLKQLDHNDLADYERNQIMRRLRQ
LIAQSWHTDEIRKIRPTPVDEAKWGFAVVENSLWEGVPAFLRELDEQLEQAFGYRLPVDA
VPVRFTSWMGGDRDGNPNVTAEVTRHVLLLSRWKAADLFLRDIQVLVSELSMSECTPDLL
ELAGGSEVQEPYRAIMKSLRSQLSSTLSYLEARLTGEERLPPKDLLVTNEQLWEPLHACY
QSLKTCGMGIIADGRLLDTLRRVRCFGVPLVRIDVRQESTRHTDALAEITRYLGLGDYES
WSESDKQAFLIRELSSKRPLLPRYWEPSADTKEVLDTCRVIAKAPQGSIAAYVISMARTP
SDVLAVQLLLKEAGCPFALPVAPLFETLDDLNNADDVMTQLLSIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYRAQDALIKTCEKAGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLALYTGAILEANLLPPPEPKQEWHQVMDEL
SRVSCDMYRGYVRENPDFVPYFRAATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVDDGKQGQLEEMCRNWPFFSTRIGMLEMVFAKADLWLAE
YYDQRLVEEKLWPLGKQLRDQLAADISIVLAISNDDHLMADLPWIAESIALRNVYTDPLN
VLQAELLHRSRRQEQPDADLELALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgcagtaacgtcagtatgctcggcaaactactcggc
gatactatcaaggaagcactgggtgaaaacatccttgataaagtcgaaacaatccgcaag
ttgtcaaagtcatcccgtgcaggtaatgaaaaacatcgtcaggaactgctgactacactg
caaaacctgtctaacgatgagctgttgcccgtggcccgcgcatttagccagttccttaac
ctgaccaataccgctgagcaatatcatacgatttcaccacacggcgaagcagcgagtaac
ccagcgcagctttccaacgcctttgagcgtctaaaagaaaataaagatctgaccgaacgc
gatatccgcgacgcggtagaatcgctgtcgatcgagctggtactgaccgcacacccgacc
gagatcacccgccggacgctgatccacaaactggtagaagtgaacacctgccttaagcag
ctcgaccacaacgatttggctgattatgagcgcaatcagatcatgcgccgtctgcgccag
ttgatcgcacagtcctggcataccgatgagatccgcaaaattcgccctaccccggtagat
gaagccaaatggggtttcgccgtagtggaaaacagtctgtgggaaggcgtacctgcattt
ttacgtgagctcgatgagcagttggaacaggctttcggctaccgtctgccagttgacgcc
gtaccggtacgctttacctcctggatgggcggcgaccgcgacggtaacccgaacgtcaca
gcagaagtgacgcgtcatgtgctgttactcagccgctggaaagccgccgatctgttcctg
cgtgatattcaggtactggtttccgagctgtcgatgtccgaatgtacaccagatctgtta
gagctggccggtggcagcgaggtacaggagccgtaccgcgccatcatgaagtcactgcgt
tcgcagttgagcagcacgctgagctatctcgaagcacgcctgacgggtgaagaacgtctg
ccccctaaagacctgctagttaccaacgagcagctatgggaaccgctccacgcctgctat
cagtctctgaaaacctgcggcatgggtatcatcgccgatggtcgcctgctggatacgctg
cgccgcgtgcgctgcttcggtgtaccgttggtgcgcattgatgtccgtcaggagagtact
cgccacaccgacgcactggccgaaattacccgctatctgggtctgggcgattatgaaagc
tggtcagaatccgataagcaagccttcctgatccgcgaactcagctccaagcgtccgctg
ctgccgcgctactgggaacccagtgcagataccaaagaagtgctggatacctgccgggtg
atcgcgaaagcgccacagggttctattgctgcttacgttatttcaatggcgcgcacgcct
tccgacgtgctggccgttcaactgctgctcaaagaagccggctgcccgtttgctctgccc
gtcgcgccgctgtttgaaacactggatgacctgaacaacgccgacgatgtcatgacgcag
ttgctaagcattgactggtatcgcggctttattcaaggcaagcagatggtcatgatcggc
tattccgactctgcgaaagacgcaggcgtgatggccgcatcctgggcgcagtaccgtgcg
caagacgcgctgatcaaaacctgtgagaaagcgggcatcgccctgacgctattccacgga
cgcgggggttccatcggtcgcggtggtgcgccagctcatgccgcgctgttgtcacaaccg
ccgggtagcctgaaaggcggcctgcgcgtgacggaacagggcgagatgatccgctttaaa
tacggcctgccagaagtcaccatcagcagcctggcgctgtataccggtgcgattctggaa
gcgaacctgctgccaccgccggagccaaaacaagaatggcatcaggtaatggacgaactg
tcccgcgtgtcctgcgatatgtaccgtggctacgtgcgcgaaaacccagatttcgttccg
tacttccgcgccgctacgccggagctggagctgggtaaactgccgttgggctcacgcccg
gccaaacgtcgtccgaacggcggagtggaaagcctgcgcgcgatcccgtggattttcgcc
tggacgcagaaccgtctgatgctgcccgcatggctcggtgcaggtgccgcgttgcagaaa
gtggtggatgacggcaagcaggggcagttggaagaaatgtgccgcaactggccgttcttc
tcgacgcgtatcggcatgctggagatggtgtttgccaaagccgacctgtggctggcggag
tattacgatcagcgtctggtagaagaaaagctatggccattagggaagcaactacgcgat
cagttggccgccgatatcagcattgtgctggcgatctccaacgacgatcacctgatggca
gacctaccgtggatcgctgaatccatcgcactgcgtaacgtctacaccgatcccctgaac
gtgttgcaggcagaactgctgcatcgttcacgtcgacaggaacaaccggacgccgatctg
gaactggcgttgatggtcaccatcgcgggtgtcgcagcgggtatgcgtaatacgggttaa

DBGET integrated database retrieval system