KEGG   Pectobacterium wasabiae: A7983_10780Help
Entry
A7983_10780       CDS       T04535                                 

Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pws  Pectobacterium wasabiae
Pathway
pws00440  Phosphonate and phosphinate metabolism
pws01100  Metabolic pathways
pws01120  Microbial metabolism in diverse environments
pws01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pws00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    A7983_10780
Enzymes [BR:pws01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     A7983_10780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AOR63737
UniProt: A0A1D7Z1T3
LinkDB All DBs
Position
2388121..2389053
Genome map
AA seq 310 aa AA seqDB search
MSIILPHHAPTDSYKGCTPGSRRSALRELLQQQKGIRVMEAHSPLSALLIEQAAYEDGDI
HYQFDAFWSSSLTDSTLRGKPDTELVDISHRFHAITEIFDVTTRPLIFDGDTGGQTEHLS
HRIRAAENLGISAMIIEDKTGLKKNSLFGNDVKQTQASVADFCEKITTAKKAQLTPEFML
IARIESLILDVGMEDAINRALHYADAGADGIMIHSRHKNPSEILAFAKQFRDHYPHLPLV
CVPTSFNDITFDQLIDGGFNIVIYANHMLRAAYPAMKSILPEILKHGRTLEVEDQCMSIK
DILDLIPGTR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcattttacctcatcatgccccaacggattcctataaggggtgtacgccaggc
tcacgccgcagtgcgctccgtgaattattgcagcagcaaaaaggcattcgtgtgatggag
gctcacagtccgctttctgccttattaatcgagcaagctgcttatgaagatggcgatatt
cattatcaatttgatgcgttttggtctagctcgctcaccgattccactttgcgcggaaaa
cccgatacggagttagtggacatcagccatcgttttcatgcgattacggaaatatttgat
gttactacccgtccattaatttttgacggtgatactggcgggcaaacggaacatttatcc
caccgtattcgtgctgccgaaaatctgggtatttccgccatgattatcgaagataaaacc
ggcctgaaaaagaactctttatttggtaatgatgtaaaacaaacgcaggcttctgtagcg
gatttttgcgaaaaaattacgactgccaaaaaagcacaactgacgcccgagtttatgcta
atcgcgcgtattgagagcctgatcctcgacgtcggtatggaagatgcgataaaccgtgcc
ttgcattatgctgatgccggtgccgatggcattatgatccacagtcgacataagaacccc
tctgagattttagctttcgctaaacaattccgcgatcattatccacatttacctttggtt
tgtgtccctaccagttttaacgatattactttcgatcagttgattgatggtggattcaat
attgttatttacgcaaaccatatgttacgtgcggcttatcctgcgatgaaatcaatttta
ccagaaatcctcaagcatggtcgaacgctggaagttgaggatcaatgcatgtcgataaaa
gatattctggatcttatacccggcacgcgatag

DBGET integrated database retrieval system