KEGG   Pectobacterium wasabiae: A7983_11475Help
Entry
A7983_11475       CDS       T04535                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
pws  Pectobacterium wasabiae
Pathway
pws00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pws00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A7983_11475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pws01002]
    A7983_11475
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pws01011]
    A7983_11475
Enzymes [BR:pws01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A7983_11475
   3.4.21  Serine endopeptidases
    3.4.21.-  
     A7983_11475
Peptidases and inhibitors [BR:pws01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   A7983_11475
Peptidoglycan biosynthesis and degradation proteins [BR:pws01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   A7983_11475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AOR63869
UniProt: A0A1D7Z1W4
LinkDB All DBs
Position
complement(2526763..2528196)
Genome map
AA seq 477 aa AA seqDB search
MRFSSIVTGLACAFVLHANAASVEDHRQYLPDGANLALLVQKVGATTPSMAFNSQQMALP
ASTQKVITALAALLQLGPDYRFITTMESHGPVSSGILNGNLIVRFSGDPTLKRQQIRNMV
QELRKRGIQEIAGDVLIDTSVFASHDKAPGWPWNDMTQCFSAPPGAAIVDRNCFSVSLYS
APKAGDNAFIRVASYYPVQMFSEVRTLAKGSSDAQYCELDVVPGELNRFTLTGCLTQRTE
PLPLAFAIQDGASYAGAIVKDELQQADIRIKGSLRRQTQPSAAGSVLAQTQSAPLHDLLT
IMLKKSDNMIADTVFRTIGHERFSVPGTWRAGADAVRQILRQKAGVDLGNSIVVDGSGLS
RHNLISPETMMQVLQYIAQHDNQLNYITMLPLSGYDGTLRYRGGLHEAGVDGKVSAKTGA
LQGVYNLAGFITTASGQRMAFVQFLSGYAVPPEDQSARRVPLVRFESRLYKDIYQSN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttcatcgattgttaccggacttgcctgcgcttttgttctgcatgccaatgca
gcttctgttgaggatcatcgtcaatatttacctgatggtgccaatttggcgttattggta
caaaaagttggcgcaacaacacccagtatggccttcaatagccagcaaatggcgcttcct
gccagtacacaaaaggtgataaccgcattagctgcattactacaattgggcccagactat
cgattcatcaccacgatggaaagccacggccctgtctccagcggaattctgaacggtaac
ctgattgtgcggtttagcggtgatccaaccctgaaacgccagcaaatacgaaatatggtg
caggaattaaggaaacgaggaatacaggaaatcgcaggtgatgtgttgatcgatacttct
gtgtttgccagtcacgacaaagcgccgggctggccatggaacgatatgacacagtgtttc
agcgccccgccgggtgccgccattgtcgatcgcaactgtttttccgtttcgctctacagc
gcacctaaagcaggtgataacgcattcattcgcgtcgcctcctattatccggtgcaaatg
ttcagcgaagtgcgcacgctggctaaaggatcttccgatgcgcaatactgcgaactggat
gtggtccccggagaattgaatcgctttacgctcactggctgcctgactcagcgcaccgaa
ccacttccgctggcgttcgcgattcaagatggagccagctacgccggtgcaatcgttaaa
gatgaactgcagcaggcagatatccgcattaaaggcagcttacgccgacagacacaacca
agtgcagcaggaagcgtgcttgcccagacacaatcagcgccactgcatgatcttctcact
atcatgctgaaaaagtccgacaacatgattgccgatacggtttttcgcaccattgggcat
gaacgctttagcgtaccaggaacgtggcgcgcaggggccgatgccgtgcgtcagattctt
cgtcagaaggcaggtgtagatttaggaaatagtattgttgttgacggttcaggcctgtca
cgacacaacctgatttcgccggaaacgatgatgcaggtattacagtacatcgcacagcac
gataatcagctaaattacatcacgatgcttccactttcaggctatgacggcacattgcgt
taccgtggcggcctgcatgaagctggcgttgatggcaaggtttcggctaaaactggggcc
ttacagggcgtatacaatctggcaggtttcattaccactgcaagcggtcagcgcatggca
ttcgtgcagttcctgtccggctatgccgtaccaccagaagatcagagcgcacgtcgcgtc
cctctggtgagatttgaaagccgcctctacaaagacatttatcagagtaactaa

DBGET integrated database retrieval system