KEGG   Pectobacterium wasabiae: A7983_13965Help
Entry
A7983_13965       CDS       T04535                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pws  Pectobacterium wasabiae
Pathway
pws00061  Fatty acid biosynthesis
pws00780  Biotin metabolism
pws01100  Metabolic pathways
pws01212  Fatty acid metabolism
Module
pws_M00083  Fatty acid biosynthesis, elongation
pws_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pws00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A7983_13965
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A7983_13965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pws01004]
    A7983_13965
Enzymes [BR:pws01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     A7983_13965
Lipid biosynthesis proteins [BR:pws01004]
 Fatty acid synthase
  Component type
   A7983_13965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AOR64337
UniProt: A0A1D7Z3G9
LinkDB All DBs
Position
3077183..3077638
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLNIEEILELLPHRFPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAAVDEARFKRPVQPGDQMILEVEFIKE
RRGVARFKGVAKVDGEVACEASMMCARRRES
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctgaacattgaagagattttagaattattaccgcaccgt
ttcccatttttactggttgatcgggtactggattttgaagaagggaagtttctgcgggcg
gtgaaaaacgtctcttttaacgaacccttcttccaggggcatttcccgggtaaacccatt
ttccccggcgtgttgattctggaagccatggctcaggccaccggtattctggcgtttaaa
agcgtgggtaaactggagccgggtgagctgtattacttcgccgccgttgacgaagcgcgc
tttaagcgtccggtacaaccaggcgatcaaatgatccttgaagttgaattcattaaagag
cgtcgcggcgttgcgcgctttaaaggtgttgccaaagttgatggcgaagtggcctgtgaa
gcgtcaatgatgtgtgctcgtcgtcgggagtcctga

DBGET integrated database retrieval system