KEGG   Pectobacterium wasabiae: A7983_19315Help
Entry
A7983_19315       CDS       T04535                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pws  Pectobacterium wasabiae
Brite
Enzymes [BR:pws01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A7983_19315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AOR65371
UniProt: A0A1D7Z640
LinkDB All DBs
Position
4226793..4227317
Genome map
AA seq 174 aa AA seqDB search
MKLKALILTGVFFSCSTFAASTTVTLNEALPTGTGGSIGEVSLTETPYGLLFTPNLKGLD
AGIHGFHVHENASCEPAEQDGKSVPALAAGGHLDPKKTGKHLGPYNDQGHLGDLPGLVAT
ADGTSTYPILAPRIKSLSEVKNHALMVHVGGDNYADMPAKLGGGGARMACGVIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaggcacttatcctgacaggcgtgttcttttcctgttccaccttcgcggca
agcaccacggtgacgctgaatgaagcgctgcctaccggtactggcggcagtatcggtgaa
gtctcccttacggaaacaccatacggcctgcttttcacgccgaatctgaagggactggac
gcgggtattcacggattccacgtgcatgaaaatgccagttgtgaacccgccgagcaagac
ggtaaatcggttcccgcactggcggcgggcggccacctcgatccgaaaaaaacgggtaaa
caccttgggccttataacgaccaagggcatttaggcgatttacccggactggtggctact
gccgacggcacgtcaacctatccaattctggctccccgaataaaatcactgtctgaggtg
aagaatcacgcattgatggttcatgtcggcggggataactatgcggatatgccagcaaaa
ctgggtggcggcggtgcccgcatggcatgtggcgtgattaagtaa

DBGET integrated database retrieval system