KEGG   Pectobacterium wasabiae: A7983_20575Help
Entry
A7983_20575       CDS       T04535                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
pws  Pectobacterium wasabiae
Pathway
pws00040  Pentose and glucuronate interconversions
pws00051  Fructose and mannose metabolism
pws01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pws00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A7983_20575
   00051 Fructose and mannose metabolism
    A7983_20575
Enzymes [BR:pws01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     A7983_20575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AOR65612
UniProt: A0A1D7Z6Z9
LinkDB All DBs
Position
complement(4533102..4534100)
Genome map
AA seq 332 aa AA seqDB search
MATYNYPEFGAGLWHFANYIDRYAVDGYGPALSTIDQIKAAKEVGELSYVDLPYPFTPGV
TLSEVKDALKDAGLKAIGITPEIYLQKWSRGAFTNPDPAARAAAFDLMHESAGIVRELGA
NYVKVWPGQDGWDYPFQVSHKNLWKLAVDGMRDLAGANPDVKFAIEYKPREPRVKMTWDS
AARTLLGIEDIGLDNVGVLLDFGHALYGGESPADSAQLIIDRGRLFGMDVNDNLRGWDDD
LVVGTVHMTEIFEFFYVLKINNWQGVWQLDQFPFRENHVEAAQLSIRFLKHIYRALDKLD
IPALQAAQEAQNPLQAQRIVQDALLSSINVNE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtataactaccctgaatttggtgccggtttgtggcattttgcgaattatatc
gaccgctacgcggtggacggctacggcccggctttgagtacgatcgatcagatcaaagca
gcgaaagaagtcggcgaactttcctatgtcgatctgccttatcccttcacgccgggcgtc
acactgagcgaagtgaaagacgcgctgaaggatgcagggctgaaagcgattggcatcacg
ccggaaatttacctgcaaaagtggtcgcgtggcgctttcaccaatcccgatccggccgct
cgggctgcggcatttgatctgatgcacgaatctgctggcattgtgcgtgaactgggggcg
aattacgttaaagtctggccgggacaggatggttgggattatccgttccaggttagtcat
aaaaacctgtggaagctggcggttgatggcatgcgcgatcttgcaggcgctaacccggat
gtgaaattcgccatcgagtacaaaccgcgcgagccgcgcgtgaaaatgacctgggattcc
gccgcgagaacgctgttggggattgaagatatcgggttagataacgttggcgtgctactg
gacttcggccatgcactgtatggcggcgaatcaccagcggattctgcccagttgattatc
gatcgcggtcggctattcggcatggatgtgaatgacaatctgcgcggttgggatgatgat
ttggtagtcggcaccgtgcacatgaccgagattttcgagtttttctacgtgctgaaaatc
aacaattggcagggcgtgtggcagctcgatcagttcccgttccgtgagaatcacgttgag
gcggcgcaactgtccattcgtttcttgaagcatatctatcgcgcgctggacaaactggat
attccggcgcttcaggcggcacaggaagcgcaaaacccgttacaggctcagcggattgta
caggacgcgttgctgtcatccattaacgttaacgagtag

DBGET integrated database retrieval system