KEGG   Pyrus x bretschneideri (Chinese white pear): 103927248Help
Entry
103927248         CDS       T03446                                 

Definition
(RefSeq) probable fructokinase-6, chloroplastic
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00051  Fructose and mannose metabolism
pxb00500  Starch and sucrose metabolism
pxb00520  Amino sugar and nucleotide sugar metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    103927248
   00500 Starch and sucrose metabolism
    103927248
   00520 Amino sugar and nucleotide sugar metabolism
    103927248
Enzymes [BR:pxb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     103927248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 103927248
NCBI-ProteinID: XP_009334417
LinkDB All DBs
Position
Unknown
AA seq 386 aa AA seqDB search
MALHSTAFCFGGVVSLPRNSVSFSQRTVRASAFASPPPLSSSSIARLNVQGKAFAGDVLL
DTKESSLVVCFGEMLIDFVPTASGLSLAEAPAFKKAAGGAPANVAVGIARLGGSSAFIGK
VGEDEFGYMLADILKENNVNNEGMRFDPGARTALAFVTLRSDGEREFMFYRNPSADMLLQ
EAELDFDLIRKAKILHYGSISLITEPCKSAHIAATKAAKDAGVVLSYDPNLRLPLWPSAK
SAREGILSIWDTADVIKISEEEISFLTEGEDPYDENVVRKLYHPNLKLLLVTEGPDGCRY
YTKEFSGRVKGMKVDAVDTTGAGDAFVAGILSQLAVDLSLLQDEDKLRDALVFANACGAL
TVTGRGAIPALPTRESVLNVLLKSVA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggctcttcattctactgctttctgcttcggcggggtggtttctttgcctcgcaattcg
gtttcttttagtcaacggacagtcagagcctctgcatttgcttccccaccacctctcagt
tcttcctccattgccagattgaatgtccaaggaaaagcatttgcaggagatgtgctactg
gacacaaaagaatcctcccttgtggtttgtttcggggaaatgctgattgattttgtccca
actgctagtggactttcattggctgaggcacctgcatttaaaaaagctgctggaggagcc
cctgctaatgttgcagttggcatagctcgtcttggtggctcatcagcttttattggaaag
gtcggggaagatgaatttggatacatgcttgctgatatactaaaggagaataatgtgaac
aatgagggaatgcgttttgatcctggtgcacgaactgctttagcttttgttacattgagg
agtgatggggaacgtgagttcatgttttatcgtaaccctagtgctgatatgttgcttcaa
gaagctgaacttgattttgatttaattaggaaggcaaaaatattacattatggttctata
agtcttatcacggaaccatgcaagtcggctcatattgcagcaacaaaagctgcaaaggac
gctggtgtagttctgtcctacgatcccaacctcaggcttccactgtggccttccgcaaag
agtgctagagaaggaattttgagtatatgggacactgctgatgttatcaagataagtgaa
gaagagatttcttttctaacggaaggagaagatccatatgatgaaaatgttgttcgcaaa
ttgtaccatccaaatcttaaattacttctggtcactgagggccctgatggttgcaggtac
tacaccaaggaattcagtggaagagtcaagggtatgaaggtagatgcagtggacaccact
ggtgctggggacgcatttgtggctggaatattatcacaactagctgttgatctttctttg
cttcaggacgaggacaaactgagagatgcgctcgtgtttgctaacgcttgcggcgcattg
actgtgacggggagaggtgctattccggcattgccaactcgagaatcggtgttgaatgtc
cttctcaagtctgtagcctag

KEGG   Pyrus x bretschneideri (Chinese white pear): 103933335Help
Entry
103933335         CDS       T03446                                 

Definition
(RefSeq) probable fructokinase-7
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00051  Fructose and mannose metabolism
pxb00500  Starch and sucrose metabolism
pxb00520  Amino sugar and nucleotide sugar metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    103933335
   00500 Starch and sucrose metabolism
    103933335
   00520 Amino sugar and nucleotide sugar metabolism
    103933335
Enzymes [BR:pxb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     103933335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB DUF2750
Motif
Other DBs
NCBI-GeneID: 103933335
NCBI-ProteinID: XP_009341299
LinkDB All DBs
Position
Unknown
AA seq 316 aa AA seqDB search
MLIDFVPTVSGVSLAEASAFKKAPGGAPANVAVGVARLGGSAGFIGKVGDDEFGYMLSDI
LKQNNVDNSGVRFDPNARTALAFVTLRADGEREFLFFRHPSADMLLRESELDINLIKKAK
IFHYGSISLIDEPCRSTHLAAMKIAKESGCILSYDPNLRLPLWPSEDAARKGIMSIWDQA
DIIKISEDEIRFLTGGDDPYDDNVVLTKLFHPNLRLLVVTEGSEGCRYYTQKFHGRVGGV
KVKAVDTTGAGDAFVGGVLDSIASNLSLFQDEKGLREALLFANACGALTVTERGAIPAMP
TREAVLQCLKQAAEKN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgctaatcgactttgtgcccacagttagtggagtttcacttgctgaagcatctgctttt
aaaaaagctcctggtggtgctcctgctaatgtcgctgttggtgttgcaagactgggtggg
tcagcaggtttcataggcaaggtaggcgatgatgaatttggatacatgttgtctgacatt
ctaaaacaaaacaatgttgacaattctggcgttcgatttgaccccaatgcaagaactgca
ttggcttttgttacactcagagctgacggagagcgtgaattcctgtttttccgtcatcca
agtgctgatatgcttctacgtgaatcagagcttgacataaatctaattaagaaggcaaag
atcttccattatggttcaattagtttgattgatgaaccatgcaggtcaacccatctagct
gctatgaaaattgccaaggagtctggttgcatcctttcttatgacccaaatttaagattg
ccgttgtggccgtcggaagatgctgcacggaaaggcataatgagtatatgggatcaagca
gatataatcaagataagcgaggatgaaattagattcctgactggtggtgatgatccttat
gatgataatgtggtgttaacgaagctttttcatcccaatcttagactgttggtagtaact
gagggttcagagggttgcagatattacactcagaaatttcacggccgggttggtggtgtt
aaagttaaagctgttgacacaactggtgctggtgatgcattcgtcggtggggtactggac
agcatagcttctaacttgagtctttttcaggatgagaaggggctacgagaagctctactc
ttcgcaaatgcatgcggtgcgctcacagtaacagaaagaggagccattcctgcaatgccg
acgagagaagctgtgctccagtgcttaaagcaggctgctgagaaaaactag

KEGG   Pyrus x bretschneideri (Chinese white pear): 103959887Help
Entry
103959887         CDS       T03446                                 

Definition
(RefSeq) probable fructokinase-5
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00051  Fructose and mannose metabolism
pxb00500  Starch and sucrose metabolism
pxb00520  Amino sugar and nucleotide sugar metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    103959887
   00500 Starch and sucrose metabolism
    103959887
   00520 Amino sugar and nucleotide sugar metabolism
    103959887
Enzymes [BR:pxb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     103959887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 103959887
NCBI-ProteinID: XP_009370536
LinkDB All DBs
Position
Unknown
AA seq 327 aa AA seqDB search
MANSESPLIVAFGEMLIDFVPDTAGVSLAESTGFLKAAGGAPANVACAITKLGGKSAFVG
KVGDDEFGHMLINILKKNGVNAEGVCVDKHARTALAFVTLKNDGEREFMFYRNPSADMLL
KDSELNMGLIKQAKIFHYGSISLIAEPCRSAHMAAMKAAKEAGVLLSYDPNVRLPLWPSA
DAARQEIKSIWNQADFIKVSDDEVNFLTQGDSEKEDVVLSLWHDNLKLLVVTDGEKGCRY
YTKKFKGKVAGFSVKAVDTTGAGDSFVGSFLLSMANDMSIFEDEAKLKEALSFANACGAI
CTTQKGAIPALPTQSDARELISKSKAK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcgaattcagagagtccactaattgtagcgtttggggagatgctcatcgactttgtg
ccagacacggccggagtttcgttggccgagtccacggggttcctcaaggccgccggcggt
gcacctgccaatgtggcttgtgccatcaccaagcttggtggtaaatcggctttcgttggc
aaggttggagatgacgagttcggacacatgctgatcaacatattgaagaagaacggggtg
aacgcggagggagtgtgcgtggataagcatgccagaacagcgttggcgttcgtgaccttg
aagaacgacggtgaaagggagttcatgttttaccggaaccccagtgctgatatgttgctc
aaggattcggagctaaacatgggccttatcaagcaggctaagatattccactacggatcc
ataagcctcatagccgagccatgcagatcggctcatatggcagccatgaaagccgctaag
gaagctggcgttttgctttcctacgatcccaacgtcaggttgcccctctggccctctgct
gatgctgctaggcaggagatcaagagcatatggaatcaggctgatttcatcaaggtgagc
gacgacgaggtgaacttcctgacgcaaggagattctgagaaagaagatgtggttctgtcc
ctgtggcatgacaacctcaaactgctcgtggtcactgatggtgagaagggctgtagatat
tacactaagaaattcaaaggaaaggtggccggcttctcagttaaagccgtggacacaacc
ggcgccggtgattcttttgttggttcatttttgctttccatggccaatgatatgtccatc
tttgaggacgaagcaaaattgaaggaggctctgagttttgcaaatgcttgtggagctatc
tgtacaactcaaaagggtgccattccagctcttccaacccagtctgatgcccgtgagctc
atttccaagtccaaagccaaatag

KEGG   Pyrus x bretschneideri (Chinese white pear): 103960497Help
Entry
103960497         CDS       T03446                                 

Definition
(RefSeq) probable fructokinase-7
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00051  Fructose and mannose metabolism
pxb00500  Starch and sucrose metabolism
pxb00520  Amino sugar and nucleotide sugar metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    103960497
   00500 Starch and sucrose metabolism
    103960497
   00520 Amino sugar and nucleotide sugar metabolism
    103960497
Enzymes [BR:pxb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     103960497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 103960497
NCBI-ProteinID: XP_009371257
LinkDB All DBs
Position
Unknown
AA seq 358 aa AA seqDB search
MANNLAPALDIKLVLREDSKDASSDKKGGSQDDKSLVVCFGEMLIDFVPTVGGVSLAEAP
AFKKAPGGAPANVAVGIARLGGSAGFIGKVGDDEFGYMLADILKQNNVDNSGVRFDPSAR
TALAFVTLRADGEREFLFFRHPSADMLLHESELDINLIKRAKIFHYGSISLIDEPCRSTH
IAAMKIAKKSGCILSYDPNLRLPLWPSEDAARKGIMSIWDQADIIKISEDEIRFLTGGDD
PYDDNVVLTKLFHPNLRLLVVTEGSEGCRYYTQKFHGRVGGVKVKPVDTTGAGDAFVGGV
LNSIASNLSLFQDEKGLREALLFANACGALTVTERGAIPAMPTREAVLQCLKQAADKK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggctaataatctcgccccagctctggacataaaattggttttgcgtgaagattctaaa
gacgcatcctcagataaaaaaggagggtcacaagatgacaagtccctggttgtttgcttt
ggggaaatgctaattgactttgtgcccaccgttggtggagtttcacttgctgaagcacct
gcttttaagaaagctcctggtggtgctcctgctaatgtcgctgttggaatcgcaagactg
ggtgggtcagcaggtttcataggcaaggtaggtgatgatgaatttggatacatgttggct
gacattttaaaacaaaacaatgtcgacaattctggcgtgcgatttgaccccagtgcaaga
actgcattggcatttgttacactcagagctgacggagagcgtgaattcctttttttccgt
catccaagtgctgatatgcttctacatgaatcagagcttgacataaatcttattaagagg
gcaaaaattttccattatggttcaattagtttgattgatgagccatgcaggtcaacccat
attgctgcaatgaaaattgccaagaagtctggttgcatcctttcttatgatccaaattta
agattgccattatggccatcagaagatgccgcacggaaaggcataatgagtatatgggac
caagcagatattatcaagataagtgaggatgagattagattcctgacaggtggtgatgat
ccttatgatgataatgtggtgttaacgaagctttttcatcctaatcttagacttttggta
gtaactgaaggatcagagggttgcagatattacacacagaaattccatggccgggtcggt
ggtgttaaagttaaacctgttgacacaactggtgctggtgatgcattcgttggtggggta
ctcaacagcatagcttctaacttgagtctttttcaggacgagaaggggttgcgagaagct
ctactctttgcgaatgcatgcggtgcgctcacagtaacagaaagaggagccattcctgca
atgccgacaagagaagccgtgctccagtgcttaaagcaggctgctgataaaaagtag

KEGG   Pyrus x bretschneideri (Chinese white pear): 103961015Help
Entry
103961015         CDS       T03446                                 

Definition
(RefSeq) probable fructokinase-6, chloroplastic
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00051  Fructose and mannose metabolism
pxb00500  Starch and sucrose metabolism
pxb00520  Amino sugar and nucleotide sugar metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    103961015
   00500 Starch and sucrose metabolism
    103961015
   00520 Amino sugar and nucleotide sugar metabolism
    103961015
Enzymes [BR:pxb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     103961015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 103961015
NCBI-ProteinID: XP_009371791
LinkDB All DBs
Position
Unknown
AA seq 386 aa AA seqDB search
MALHATAFCFGGVVSLPRNSVSFSQRSVRASAFSSPPPLSSSSIARSNVQGKAFAGDALP
DTKESSLVVCFGEMLIDFVPTSNGLSLAEAPAFKKAAGGAPANVAVGIARLGGSSAFIGK
VGEDEFGYMLADILKENNVNNEGMRFDPGARTALAFVTLRSDGEREFMFYRNPSADMLLQ
EAELDFDLIRKAKILHYGSISLITEPCKSAHIAAAKAAKDAGVVLSYDPNLRLPLWPSAK
SAREGILSIWDTADVIKISEEEISFLTGGEDPYDENVVRKLYHPNLKLLLVTEGPDGCRY
YTKEFSGRVKGMKVDAVDTTGAGDAFVAGILSQLAVDLSLLQEEDKLRDALLFANACGAL
TVTERGAIPALPTRESVLNVILKSVA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggctcttcatgctactgctttctgcttcggcggggtggtttctttgcctcgcaattcg
gtttcttttagtcaaaggtcagtcagagcttctgcattttcttccccaccgcctctcagt
tcttcctccattgctagatcgaatgtccaaggaaaagcatttgcaggagatgcactaccg
gacacaaaagaatcctcccttgtggtttgttttggggaaatgctgattgattttgtccca
acgagtaatggactttcattggctgaagcacctgcatttaaaaaagctgctggaggagcc
ccggctaatgttgcagttggcatagctcgacttggtggctcatcagcttttattggaaag
gttggggaagatgaatttggatacatgcttgctgatatactgaaggagaataatgtgaac
aatgaagggatgcgttttgatcccggtgcacgaactgctttagcatttgttacattgagg
agtgatggggaacgtgagttcatgttttatcgtaatcctagtgctgatatgttgcttcaa
gaagctgaacttgattttgatttaattaggaaggcaaaaatattacattatggttctata
agtcttatcacggaaccatgcaagtcggctcatattgcagcggcaaaagctgcaaaggac
gctggtgtagttctgtcctacgatcccaacctgaggcttccactgtggccttctgcaaag
agtgctagagaaggaattttgagtatatgggacactgctgatgttatcaagataagtgaa
gaagagatttcttttctaacgggaggagaagatccgtatgatgaaaatgttgttcgcaaa
ttgtaccatccaaatcttaaattacttctggtcacggaaggccctgatggttgtaggtac
tacaccaaggagttcagtggaagagtcaagggtatgaaggtagatgcagtggacacgact
ggtgctggggacgcatttgtggccggaatactatcacaactagctgttgatctttcgttg
cttcaggaggaggacaaactgagagatgcgctcctgtttgctaatgcttgcggtgcattg
actgtgacggagagaggtgctattccggctttgccaactcgggaatctgtgttgaatgtc
attctcaagtctgtagcctag

KEGG   Pyrus x bretschneideri (Chinese white pear): 103964630Help
Entry
103964630         CDS       T03446                                 

Definition
(RefSeq) probable fructokinase-7
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00051  Fructose and mannose metabolism
pxb00500  Starch and sucrose metabolism
pxb00520  Amino sugar and nucleotide sugar metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    103964630
   00500 Starch and sucrose metabolism
    103964630
   00520 Amino sugar and nucleotide sugar metabolism
    103964630
Enzymes [BR:pxb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     103964630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Nup160 DUF2750
Motif
Other DBs
NCBI-GeneID: 103964630
NCBI-ProteinID: XP_009375843
LinkDB All DBs
Position
Unknown
AA seq 372 aa AA seqDB search
MAPTGCSCFPVTLERSKKGSFKFVRNSSSLSGSSKLLSLKKKSSIQEKNSELIVCFGEML
IDFVPTSAGVSLADADGFKKAAGGAPANVAVGISRLGGSAAFMGKVGKDEFGYMLADILK
ENNVDNSGMRFDPHARTALAFVTLRSDGEREFMFYRNPSADMLLQEKELDVNLIKKAGIF
HYGSISLIEEPGRSAHLAAMDIAKKAGCILSYDPNLRLPLWPSAEAAQKGIMSIWNQADI
IKISEEEIEFLTGGDDPYDDEVVFKKLYHPNLKLLLVTEGPAGCRYYTKEFKGKVAGIKT
DAVDTTGAGDSFVAAILNGLGSDINLYKDEQKLREALLFANGCGALTVQKKGAIPALPTK
EAVNQLLQQTTA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggctccaacaggatgcagctgcttccctgtcacacttgagcgatccaaaaagggcagc
ttcaagtttgttaggaattcttcatctctttctggttcatctaaattgttatctttaaag
aaaaagagtagtatccaagagaagaactcagagctgattgtttgctttggggagatgttg
atcgacttcgtcccgactagtgccggagtttcccttgcagatgcagatggtttcaagaaa
gctgctggtggagctccagccaatgttgcagttggaatttcaagattgggaggctcagca
gcttttatgggcaaggttggtaaagatgaatttggatacatgttggctgacattctgaaa
gaaaacaacgtggacaattctgggatgcgttttgatccgcatgcgcggactgcattggca
ttcgttacactaagaagtgacggggagcgagaattcatgttctaccgcaacccaagtgct
gatatgcttcttcaggaaaaagaacttgatgtcaatctgattaaaaaggccggcatattt
cactatggatcaattagtttgattgaggaaccgggcagatcagctcatcttgctgcaatg
gacattgccaaaaaggccggttgtatcctctcttacgacccgaatctgagattgccactg
tggccatctgcagaggctgctcagaaaggcattatgagcatatggaaccaagctgacatt
attaagataagcgaggaagaaattgaattcttaaccggaggtgatgatccttatgatgat
gaggtggtctttaaaaagctttaccaccccaatctgaagcttctgcttgtaactgaaggg
ccagcaggctgcagatactacacaaaggaatttaagggtaaggttgcaggtatcaaaact
gatgctgttgacactactggtgccggtgattcttttgttgctgcgatactcaacggcttg
ggttcagacattaatttgtacaaggatgaacaaaaacttagagaagctctcttgtttgcc
aatggttgtggtgctctgacagtgcaaaagaaaggagccattcctgcactgcctacaaaa
gaagctgtgaaccaacttcttcaacaaaccactgcttga

DBGET integrated database retrieval system