KEGG   Pyrus x bretschneideri (Chinese white pear): 103928628Help
Entry
103928628         CDS       T03446                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb03030  DNA replication
pxb03410  Base excision repair
pxb03420  Nucleotide excision repair
pxb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103928628
   03410 Base excision repair
    103928628
   03420 Nucleotide excision repair
    103928628
   03430 Mismatch repair
    103928628
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pxb03032]
    103928628
   03400 DNA repair and recombination proteins [BR:pxb03400]
    103928628
Enzymes [BR:pxb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103928628
    6.5.1.6  DNA ligase (ATP or NAD+)
     103928628
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103928628
DNA replication proteins [BR:pxb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103928628
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103928628
DNA repair and recombination proteins [BR:pxb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103928628
   NER (nucleotide excision repair)
    Other NER factors
     103928628
   MMR (mismatch excision repair)
    Other MMR factors
     103928628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 103928628
NCBI-ProteinID: XP_009335981
LinkDB All DBs
Position
Unknown
AA seq 796 aa AA seqDB search
MLSRSLCSCHCLRLPSLLRLHYPIALFRPKPSSLPLISLSPQNPNLRAMSSRPSAFDALM
SGARAAAAKKKPQRSPSKKRQALDSTDPIKKPQLLPTPESAGATQDPEPVEVKAPESKEI
KEAQESSGNGGEVLPAGKKVCVVAGAKERTEELKSRMPLLKKKAGEFDPKLVANWGQGER
VPFVFVCLVFNLIDKETGRIVITDIVCNMLRTVMYTTPEDLVPVIYLAANRIAPAHEGLE
LGIGDASIVKALAEAFGRTEAHVKKQYKELGDLGHVAKESRSSQSMMRKPDALTVTKVFS
TFRQLAKESGKDSQEKKKNHIKALLVAATDCEPLYLIRLLQTKLRIGLAEQTLLTALGQA
AVYTEKHSTPPSHIQSPLEEAAKIVKQVYSLLPDYDKIIPALLSGGVWNLPEICNFTLGV
PVGPMLAKPTKGVSEIVQKFQDTEYTCEYKYDGERAQIHFMENGSVEIYSRNAERNTGKY
PDVVAAVSRLKKSSVTSFVLDCEIVAYDREKQKILPFQVLSTRARKNVSLSEIKVEVCIF
AFDMLYLNGRPLIQEQLKVRRECLYDSFVEEAGFFQFATALTSNDIDEIQKFLDAAVSSS
SEGLIIKTLTKDATYEPSKRSLNWLKLKKDYMDSIGDSLDLVPIAAFHGRGKRTGVYGAF
LLACYDSNNEEFQSICKVGTGLTEAMLEERSASLRTKVIPKPKSYYRYHDTMNPDVWFEP
SEVWEVKAADLTISPVHRAAVGIVDANKGISLRFPRLIRVREDKPPEQATSSEQVAELYN
AQAINHSNNQNDNEDD
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgctctcacgatcactctgttcttgccattgtctacgcctcccctctctcctccgtctc
cattaccccatcgccctcttccgccctaaaccctcttcactccctctcatttccctctcc
ccccaaaaccctaatcttcgtgccatgtcctcccgcccctccgccttcgacgccctcatg
tccggcgcccgcgccgccgccgccaagaaaaagccccagcgttcgccctccaagaagcgc
caagccctagactccactgaccctatcaaaaaaccccaattgctgcctacgcccgaaagc
gccggcgcaacccaagacccagaacccgtggaagtcaaagctccggaatccaaggaaatt
aaagaagctcaagaaagttctggcaatggcggtgaggtgcttccggcagggaagaaagtg
tgcgtggtggcgggtgctaaggagcggactgaggaattgaagagccgaatgccgctactg
aagaagaaagccggggaatttgacccaaaattggtggcaaattggggccagggcgagagg
gttccttttgtgtttgtttgtttagttttcaatttgattgacaaagagacgggtcggatt
gtgatcacggatattgtttgtaacatgttgaggactgtaatgtacaccacgcctgaggat
ttggtgcctgtgatttatcttgcggcgaataggattgctccggcgcatgagggtttggag
cttggaattggggatgcttcgattgttaaggcccttgcagaggcttttgggaggactgaa
gcgcatgtgaagaagcaatacaaggagctgggagatcttggtcatgttgcaaaggaaagc
cgttcttcacaatctatgatgcgcaagcctgatgcattaactgtcaccaaggtttttagt
acatttcgtcaactagctaaggaatctgggaaggatagtcaggagaagaaaaagaaccat
atcaaggcacttcttgttgctgccactgattgtgaacctctatatctgatccgtttgctt
cagacaaagttgcgaattggattggcagagcagactctattaactgcattgggacaagct
gcagtgtatactgaaaaacattcgacaccaccttctcatattcagagtcctctagaagag
gcagcaaagattgttaagcaagtgtactctctgcttcctgattacgataaaatcatccct
gcccttttaagtggaggtgtatggaatcttccagaaatatgcaactttactttgggcgtc
ccagttgggcctatgctagcaaaaccaactaaaggggtatctgaaattgtacagaagttt
caggatacagaatacacgtgtgaatacaagtatgatggagaacgtgcccagatacatttc
atggagaatggttctgttgagatatacagtcgaaatgcagaacgaaacactggaaagtat
cctgatgtggttgctgcagtgtcgaggttaaagaagtcatctgtaacatcatttgttttg
gattgtgaaattgttgcttatgaccgtgaaaaacaaaaaattctgcccttccaggtactc
agcactagagcgcgtaaaaatgtgagcttgagtgagatcaaggttgaagtctgcatattt
gcttttgatatgttgtatcttaatggccgaccacttattcaggaacaactgaaagttcgt
agagagtgtctgtatgactcttttgtggaagaagctgggttttttcagtttgccacagcc
ttaacatcaaatgatattgatgaaatacaaaagtttcttgatgctgctgtcagttcaagt
tctgagggtttaattattaaaacattgaccaaagatgctacttacgagccttcaaagcgg
tcacttaactggctgaaattgaagaaagattacatggacagtattggggactcactagac
ttggtgcctattgctgctttccatggccggggaaaacgtacaggtgtctatggtgctttc
ctcctcgcttgttatgatagcaataatgaagagtttcaaagcatttgtaaagtaggcact
ggactcactgaagcaatgcttgaagaacgttctgccagtctccgtactaaagtgataccc
aaacctaagtcatactataggtatcatgatacaatgaatccagatgtatggtttgaaccc
tcagaggtttgggaggtgaaagctgcagacctgactattagcccagttcatcgtgctgca
gttggcatagtggatgctaataagggtatttctctccggtttccacgtcttattcgagtt
cgggaagacaaacctccggagcaagccacatcatctgagcaggtagccgagttgtataat
gctcaagcgatcaaccattcaaacaatcaaaatgacaacgaagatgattag

DBGET integrated database retrieval system