KEGG   Pyrus x bretschneideri (Chinese white pear): 103928816Help
Entry
103928816         CDS       T03446                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00630  Glyoxylate and dicarboxylate metabolism
pxb00710  Carbon fixation in photosynthetic organisms
pxb01100  Metabolic pathways
pxb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    103928816
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103928816
Enzymes [BR:pxb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     103928816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small Swm2
Motif
Other DBs
NCBI-GeneID: 103928816
NCBI-ProteinID: XP_009336182
LinkDB All DBs
Position
Unknown
AA seq 180 aa AA seqDB search
MSAAIFIAPVCASGYAGLKANPRKLFPVNDSIGWAKKTVSNGSRTLCMKVWNPINNKKFE
TLSYLPPLSDDSIAKEIDYMLKKGWIPCLEFDEVGYVYRENSQMPGYYDGRYWTLWKLPM
FGCTDPSLVLNEIQQCKTEYPNAYIRCMAFDNVNQGQCMAFIIQKPTATAAAATTTTADA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgcgatctttattgctccggtttgtgcatccggttatgctggcttgaaagcc
aaccctcggaaactttttccggtgaatgattctattggatgggccaagaaaacggtctcc
aatggatcaagaactctctgcatgaaggtgtggaatccaatcaacaacaagaagttcgag
accctctcgtacctaccaccactctctgatgattctattgcgaaggagattgactacatg
ctcaagaagggatggatcccttgcctcgaattcgatgaggttgggtatgtttacagggag
aatagccagatgccagggtattatgatgggagatactggacattgtggaagctgcccatg
tttggttgtactgatccgtcgctagttctcaatgaaatccagcagtgcaaaacagaatac
ccgaatgcttatattcgctgcatggcattcgacaacgtcaaccagggtcagtgcatggcc
tttatcattcagaagccaacagctactgccgccgccgccaccaccaccaccgccgatgct
taa

DBGET integrated database retrieval system