KEGG   Pyrus x bretschneideri (Chinese white pear): 103929117Help
Entry
103929117         CDS       T03446                                 

Definition
(RefSeq) nucleoside diphosphate kinase 2, chloroplastic-like
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00230  Purine metabolism
pxb00240  Pyrimidine metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
pxb04016  MAPK signaling pathway - plant
Module
pxb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
pxb_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103929117
   00240 Pyrimidine metabolism
    103929117
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    103929117
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pxb04131]
    103929117
Enzymes [BR:pxb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     103929117
Membrane trafficking [BR:pxb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    103929117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 103929117
NCBI-ProteinID: XP_009336542
LinkDB All DBs
Position
Unknown
AA seq 231 aa AA seqDB search
METVAVFGGASPGFPSSLQRRRSCSSLPSAHHKPNLRAHHHHQLSAFPSSLHLFSYFPAR
PHARTLSKPRIFLPHLVASLEQVDETYIMVKPDGVQRGLVGEIISRFEKKGFKLTGLKLF
QCPQDLAEEHYKDLKGKSFFPKLIDYIVSGPVVCMVWEGVGVVAAARKLIGATNPLQAEL
GTIRGDLAVQTGRNVVHGSDSPENGKREIALWFKEGELCQWTPVQAPWLRE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccgtggcagtgtttggcggagcaagtccaggctttccctcatcccttcaacgc
agaagaagctgcagtagcttaccctccgcccaccacaagcctaacctacgcgcccaccac
caccaccaactatctgcattcccttcaagcctccatcttttctcatatttcccagctcgt
ccccatgccagaaccctctccaaacctcgcatctttcttccccacttggttgcttcactg
gaacaagttgatgagacgtacataatggtgaagcctgatggagttcaacgtggccttgtt
ggagagataatctcaaggtttgaaaagaagggatttaagctgactggcttgaagctcttc
cagtgcccccaagatttggcagaggagcattataaggatctcaagggaaagtcgttcttc
cccaaattgatcgactacattgtatctggccccgttgtgtgcatggtatgggagggtgtt
ggtgttgtcgctgcagcacgtaagttgattggggctacaaatcctctacaagctgaactg
ggaactatcagaggggatcttgctgttcaaacaggaaggaacgtggttcatgggagtgac
agccccgaaaatggaaagcgtgaaatagctctctggttcaaagaaggtgaattatgtcag
tggacaccagttcaagcaccgtggttaagggagtga

DBGET integrated database retrieval system