KEGG   Pyrus x bretschneideri (Chinese white pear): 103930715
Entry
103930715         CDS       T03446                                 

Definition
(RefSeq) beta-glucosidase 12-like
  KO
K13032  prunasin beta-glucosidase [EC:3.2.1.118]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00460  Cyanoamino acid metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    103930715
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.118  prunasin beta-glucosidase
     103930715
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-GeneID: 103930715
NCBI-ProteinID: XP_018498890
LinkDB
Position
Unknown
AA seq 515 aa
MAMHELGSLLLCVLLLNGFALTNTKAAKPDKPIVCNSLDRTKFDALKPGFVFGGSTAAYQ
VEGAWNVDGRGPSIWDTFTHDHPEKIDDRSNGDVAIDQYHLYKKDVAIMKDMKLDAYRFS
ISWSRLLPNGTLSGGVNRKGIEYYDNLINELLRNGIQPFVTIFHWDVPQALEDAYGGFLS
PRIVDDFKDYAKLCFSRFGDRVKHWITLNEPYTFSNHAYTIGIYAPGRCSAWQDPTCLGG
DSATEPYLVTHYQLLAHAAAVKVYKDKFQAYQNGVIGITLLSHWFEPASDAKKDIDAANR
AMDFMFGWFMDPITRGDYPYTMQYLVRERLPKFTEEESKMLTGSFDFVGLNYYTALYATD
VPKNYSKPASYLYDPHVITMTECDGIPIGPQAASDWLYVYPKGIHDFVLYTKNKYGDPII
YITENGVDEFNDSTLSLEEVLHDTNRTDYYNRHLCYLQAAIKKGSNVKGYFAWAILDNFQ
WSEGYTVRFGINYVDFDGLQRHPKLSTYWFKNFLK
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggcaatgcatgagttaggctctttgctcttgtgtgtcttgctacttaatggctttgca
ttgacaaacaccaaagctgctaagccagataaacccattgtctgtaactcacttgacagg
accaagtttgatgctctaaaaccagggttcgtctttggtggatctacagcagcttaccag
gtagaaggtgcatggaacgtagatggtagaggaccaagcatatgggacacctttacccac
gaccatccagaaaaaatcgatgatcgcagcaatggagatgttgccattgatcaataccac
ctctataagaaagatgtagcaattatgaaggatatgaagttggatgcttataggttctct
atctcatggtccagattgttaccaaatggcacgctaagtgggggtgtcaacaggaaagga
attgaatactacgacaatctcatcaatgaactccttcgcaatggcatacaaccatttgtg
acaatctttcactgggatgttccccaagcgttagaagatgcatatggtggtttcttaagc
cctcgtattgttgatgactttaaagactacgcaaaactttgtttttcacgttttggtgat
cgggtgaagcactggatcacgttgaatgagccatatacctttagtaaccatgcatataca
atcgggatctacgcaccgggtcgatgctctgcttggcaagacccaacctgccttggtgga
gattcggctactgaaccctatttggtaacacactaccaactccttgctcatgcagctgct
gtaaaagtgtacaaagataaatttcaggcatatcaaaatggggtgataggaataacacta
ctgtcacattggtttgagcctgcttcagatgcaaagaaagatatagatgctgcaaatcga
gctatggattttatgtttggatggtttatggatccaattacaagaggtgactacccgtac
accatgcaataccttgttagagaacgattgccaaaattcacggaagaagaatccaagatg
ttaactgggtcttttgattttgttggattgaactattatactgctctatatgcaactgat
gtacctaagaattattctaaacctgcaagttacttatacgatccacatgttattacaatg
actgaatgtgatggcattcctattggtcctcaggctgcttcagactggttatatgtttat
ccaaaaggaattcacgattttgtactctacacgaagaataagtatggtgatccaatcatt
tacattactgagaatggcgttgatgagttcaatgattccaccttatcactagaagaagtc
ctccatgataccaataggactgactactacaatcgccacctttgttaccttcaagcagca
atcaagaagggtagtaatgtgaaaggatactttgcatgggcaattttagacaactttcaa
tggagtgaaggctacacagttcgatttggtattaactatgtggattttgacggactccaa
aggcacccaaaactttcgacctattggttcaaaaatttcctcaagtag

DBGET integrated database retrieval system