KEGG   Pyrus x bretschneideri (Chinese white pear): 103933119Help
Entry
103933119         CDS       T03446                                 

Definition
(RefSeq) beta-galactosidase 17
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00052  Galactose metabolism
pxb00511  Other glycan degradation
pxb00531  Glycosaminoglycan degradation
pxb00600  Sphingolipid metabolism
pxb00604  Glycosphingolipid biosynthesis - ganglio series
pxb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103933119
  Lipid metabolism
   00600 Sphingolipid metabolism
    103933119
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    103933119
   00604 Glycosphingolipid biosynthesis - ganglio series
    103933119
   00511 Other glycan degradation
    103933119
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     103933119
Exosome [BR:pxb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103933119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 DUF3285
Motif
Other DBs
NCBI-GeneID: 103933119
NCBI-ProteinID: XP_009341041
LinkDB All DBs
Position
Unknown
AA seq 716 aa AA seqDB search
MKYKKKNHTSASSSKLSTMVRRRSTTLTWFFLIFLSLIAFGIFVPVFALLPPLSSHSPHQ
QLQHHPSTKRNQDHAKKFEISEDKFWKDGQPFQIIGGDLHYFRVLPEYWEDRLLRAKALG
LNTIQTYVPWNLHEPRAGILDFDGIADLVAFLKLSQKLGMLVMLRPGPYICAEWDLGGFP
PWLLAINPAPRLRSSDPIFLQLVDTWWGILLPKVAPLLYGSGGPVIMVQIENEFGSYGND
KAYLHHLVSVARKHLGEDAILYTTDGGSRETLEKGTIRGDAVFSAVDFTTGDDPWPIFEL
QREFNAPGKSPPLSSEFYTGWLTHWGEKNAQTDAAFTAAALKKILERNGSAVLYMAHGGT
NFGFYNGANTGSDESDYKPDLTSYDYDAPIRESGDVNNAKFKAIRRVVEQHSLGSIPAVP
ADNEKKAYGSIHVTKTGTLFDMIHYFDMVESESPISMESAGQMFGFMLYVTEYAAKDNGG
GVVSIPKVHDRAQVFVMCSSEDGHGRPKYVGTFERWSNQPLTLPNTKCRSNISLFVLVEN
MGRLNYGPYIFDRKGILSPVYLDGRILRRWKMHLIPIGNLNEVPKINPIIQASHSGVITM
SARKRLKPKKSGNDSNVPAFYAGYISISKEDEIKDTFISLSGWGKGIVTINNFNIGRFWP
LRGPQCNLYVPAPVLRRGNNVVVIFEIESPNPELVVRFVDQPDFTCGPGKSNVHQL
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacaagaagaagaatcatacctcagcgtcaagctccaaattgtcaacaatggtg
aggaggagaagcacgacactcacctggtttttcctcatctttctctctctaatagccttt
ggcatctttgtccctgtctttgctcttctacctcctctctcttcccactctccccaccaa
caactgcagcaccatcccagcaccaaaaggaatcaggatcatgccaaaaagtttgaaatt
tcagaggacaagttctggaaggatggtcagcctttccagatcattgggggtgacttgcac
tatttccgggttcttcctgagtactgggaagataggttgttgagagcaaaggcattggga
ttaaatacgattcaaacttatgttccctggaacctacatgaaccaagagctggtattttg
gattttgacggtattgcagatttggttgcatttctcaaactctcccagaagctgggtatg
cttgtaatgcttcgacctggaccatatatatgtgcagagtgggatttgggaggtttccct
ccttggttacttgccatcaatccagctcccagactacgatcatcagatcccattttcctt
cagttggttgatacatggtggggaatcctgcttccaaaggtagctccccttctttatgga
agtggaggtcctgttataatggttcagattgaaaacgaatttggatcatatgggaacgac
aaagcttatcttcatcacctggtgtcagtggctagaaagcaccttggggaagatgcaatt
ttgtataccacagatggaggttcaagggaaacactagagaaaggaacaattcgtggagat
gctgtcttttcagctgttgatttcactactggtgatgatccttggcctatatttgagttg
caaagggagttcaatgcccctgggaaatcaccaccactttcttcagagttttacacaggc
tggcttacacattggggagagaagaatgcgcagactgatgctgcttttacagcagctgcc
ttgaaaaagattttggaaagaaatggttctgcagtgctttatatggcacatgggggaaca
aactttgggttttataatggagcaaataccggttcagacgagtctgattacaagcccgac
ctcacttcctatgattatgatgcaccgatcagggaatccggggatgtaaacaatgcaaaa
ttcaaagcaattaggagggtcgtagagcaacacagtctaggatctatccctgcagttcca
gccgataatgagaagaaagcatatggatccattcacgtaactaaaacagggactttattt
gatatgatccattactttgatatggttgaatccgagagcccaatatctatggagtcagcg
ggacagatgtttggatttatgttatacgtgactgagtatgctgcaaaagacaatggtggc
ggagttgtatccataccaaaggtgcatgacagagcccaagtttttgtaatgtgctcttct
gaagatggtcatggaagaccaaaatatgttggcacttttgaaagatggtcaaatcaacct
ctaacccttcctaatacgaaatgccgctctaacatcagcttatttgtgttggttgaaaac
atgggccgtctaaattatggaccatatatctttgacaggaagggtattctgtctcctgtt
tatcttgatgggagaattctccgaagatggaaaatgcatttgatacctataggaaatctg
aatgaggttcctaaaatcaatcccataattcaggcttcacattctggagtcattactatg
tcagcgcgcaaaagattaaaaccgaaaaagtctgggaatgattcgaacgtgccagcattc
tatgctggatatatttctatcagcaaagaagacgaaatcaaagatacattcatatcattg
agtggctggggtaaagggatagtgactattaacaatttcaacatcggaagattttggccg
ttaaggggaccgcagtgtaacctctatgttcctgctcctgtccttcggcgtgggaataat
gttgtggtcatatttgagatagagtccccaaacccggagcttgtggtacgctttgttgat
cagccagacttcacttgtggtccagggaaatcgaatgtacatcagctttag

DBGET integrated database retrieval system