KEGG   Pyrus x bretschneideri (Chinese white pear): 103934447Help
Entry
103934447         CDS       T03446                                 

Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1-like
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pxb01001]
    103934447
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pxb04131]
    103934447
Enzymes [BR:pxb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103934447
Protein kinases [BR:pxb01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   103934447
Membrane trafficking [BR:pxb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    103934447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH_3 Kinase-like APH Seadorna_VP7 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 103934447
NCBI-ProteinID: XP_009342472
LinkDB All DBs
Position
Unknown
AA seq 488 aa AA seqDB search
MLAMEKDFDAKLKIQGNSSNGANSNVPRSKSFAFRAPQEHFTIQDFELGKIYGVGSYSKV
VRAKKKDTGTVYALKIMDKKFITKENKTAYVKLERIVLDQLDHPGIVRLFFTFQDSFSLY
MALESCEGGELFDQITRKGRLSEDEARFYAAEVVDALEYIHSMGLIHRDIKPENLLLTSE
GNIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWAL
GCTLYQMLSGTSPFKDASEWLIFQRIIARDLRFPNNFSEEAKGLIDRLLDLDPSRRPGAG
PDGYAALKMHPFFKGVDWKNLRAQTPPKLALETGSDKGDSRDNSWNPLHIGDGAAKQNEG
NSGATSSSEGSGHVTRLASIDSFDSKWQQFLEPGESVLMISMVKKIQKLTSKKVQLILTN
KPKLIYVDPAKLIVKGNIIWSDNSNDFSIQVASPSQFKICTPKKVLQFEDAKQRAWQWKK
AIEGLQNR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgttggcaatggagaaagattttgatgctaagttgaagattcaggggaattcttctaat
ggtgccaacagcaatgttccgagatccaagagtttcgctttcagggctccccaggagcat
ttcaccattcaagactttgaattgggcaagatctatggcgttggttcctactccaaggtt
gtgagagctaagaagaaggacactggaactgtctatgcattaaagatcatggacaaaaaa
ttcatcaccaaagaaaataaaacagcttatgtgaagttggaacgtattgttcttgatcag
ctggatcatccaggaattgtgcggctattctttacctttcaagattccttttcattgtac
atggcacttgaatcctgtgaaggtggagaactttttgatcaaataactaggaaaggtcgt
ctctctgaggatgaagctcgcttctatgcagcagaagttgtagacgcacttgaatacata
catagtatgggattgattcacagagatataaagccagagaacttgcttcttacatcagag
ggtaacattaagattgctgattttgggagtgtaaagcccatgcaggatagccgaattaca
gttcttccgaatgcagcatcagatgataaggcctgcacatttgtggggacagctgcttat
gtccctcccgaagtcctgaattcttcgcctgcaactttcggaaatgacctctgggcactt
ggttgcaccttgtaccaaatgctttcaggaacttctccgttcaaagatgcaagcgagtgg
cttattttccaaagaattatagcaagagatcttaggtttccaaataatttttcagaggaa
gctaaaggccttatcgaccggttattggatttagatcccagcagaagaccaggtgccgga
ccggatggttatgctgcactgaagatgcatccattctttaagggagttgactggaaaaat
ttacgagcacaaactcctccaaaactggctttggagacagggtcagataagggtgatagc
cgcgataactcatggaaccccttacacattggagatggtgcagcaaaacaaaatgagggt
aacagtggtgccacatcttcttctgaaggatctggtcatgtaactaggcttgcttcaatt
gattcctttgattccaaatggcagcaattcctggagcctggagagtcggttcttatgatc
tcaatggtgaagaaaattcagaaactgacaagcaagaaggtgcagcttatcctcaccaac
aagccaaaattgatttatgtggatcctgcaaagctaatagtgaagggaaatataatctgg
tcggacaactctaatgacttcagcatccaagtcgctagtccatcacagttcaagatttgt
acgccgaaaaaggtactgcaatttgaggatgcaaaacaaagagcttggcagtggaagaag
gcaattgaggggcttcaaaataggtga

DBGET integrated database retrieval system