KEGG   Pyrus x bretschneideri (Chinese white pear): 103935947Help
Entry
103935947         CDS       T03446                                 

Definition
(RefSeq) mitochondrial import receptor subunit TOM7-1-like
  KO
K17771  mitochondrial import receptor subunit TOM7
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pxb04131]
    103935947
   03029 Mitochondrial biogenesis [BR:pxb03029]
    103935947
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pxb02000]
    103935947
Membrane trafficking [BR:pxb04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103935947
Mitochondrial biogenesis [BR:pxb03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    103935947
Transporters [BR:pxb02000]
 Other transporters
  Primary active transporters [TC:3]
   103935947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tom7
Motif
Other DBs
NCBI-GeneID: 103935947
NCBI-ProteinID: XP_009344055
LinkDB All DBs
Position
Unknown
AA seq 73 aa AA seqDB search
MASRISPKSKGKTPAKLSKGSEERSVAQSFKEWSTWALKKAKVVTHYGFIPLVIIIGMNS
EPKPQLSQLLSPV
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgagaatatctccgaagagcaagggcaagactccggcgaagctctccaagggc
tcggaggagcgctcggtggctcaatccttcaaggagtggagcacgtgggccctgaagaag
gccaaggttgtcacccattacggcttcattcccctggtcatcatcatcggcatgaactcg
gaacccaagccgcaactttcccaacttctcagccccgtctga

DBGET integrated database retrieval system