KEGG   Pyrus x bretschneideri (Chinese white pear): 103936128Help
Entry
103936128         CDS       T03446                                 

Definition
(RefSeq) phosphopantothenate--cysteine ligase 2-like isoform X1
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00770  Pantothenate and CoA biosynthesis
pxb01100  Metabolic pathways
Module
pxb_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    103936128
Enzymes [BR:pxb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     103936128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP
Motif
Other DBs
NCBI-GeneID: 103936128
NCBI-ProteinID: XP_009344242
LinkDB All DBs
Position
Unknown
AA seq 326 aa AA seqDB search
MALSNGLEVQKEIPDAEIKSFFDSAPPLKNSDDISGKLEGFVKKNSTPSGSGGARRVVCV
TSGGTTIPLEQRCVRYIDNFSSGHRGAASTEYFLKAGYAVIFLYRRGTCQPYCRSLPADP
LLECFEYTDDSNINVYQSHSEAVRNAITESHAAVTGGLLLKLPFTTIFEYLQMLQMIAFS
IRSLGPHAILYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMRLVQVPKMLLVLRKDWAPTA
FCISFKLETDSKILLEKADMALKKYKVHMVVANELSTRKEEVVVVRRNEKISVRRNQSLG
VDDVEKPLIDLIVGRHSAYLENPDLW
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctttatcaaatgggttggaagttcaaaaagaaataccggatgctgaaatcaagtca
ttttttgactcagctcctcctttgaagaacagtgatgatatcagtggaaagcttgaggga
tttgtgaagaagaattcgacaccttctggaagtggaggagctaggagggttgtgtgtgtg
acatcaggtggcaccaccattcctctggagcaacgatgtgttcgctacatcgacaacttc
agctcaggtcacaggggagcagcatccacagagtactttttgaaggcaggttatgctgtt
atttttctatatcgaaggggtacttgccagccatattgcagatcacttcccgctgatcct
ttgcttgaatgttttgaatatacggatgactcaaatattaacgtgtaccagtcacattcg
gaagcagtgaggaatgccatcactgaaagtcatgctgcagtaacaggaggcctcttgtta
aaacttcccttcacaaccatatttgagtatcttcagatgttgcagatgattgctttttca
ataagaagtctcgggccacatgcaattctttaccttgcagctgcagtgtctgacttttat
gttccttggaaaagcatggcagaacacaaaattcagtcaggatctggtccattggacatg
cgacttgttcaggtgccaaagatgctattagtgctgaggaaagactgggcgccaacggcc
ttctgtatatcatttaagctagagacggattcgaagattcttttggagaaggctgatatg
gctcttaagaagtacaaggtgcatatggttgtagcaaatgagctttcaacccgcaaggaa
gaggttgtagttgtcagacgcaatgaaaagatatcagttcgccgaaaccagtctctgggt
gttgatgatgtggagaaaccgcttattgaccttatcgtgggaagacattcggcttatctc
gagaatcctgatttatggtaa

DBGET integrated database retrieval system