KEGG   Pyrus x bretschneideri (Chinese white pear): 103937111Help
Entry
103937111         CDS       T03446                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00010  Glycolysis / Gluconeogenesis
pxb00562  Inositol phosphate metabolism
pxb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103937111
   00562 Inositol phosphate metabolism
    103937111
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103937111
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103937111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4398 DUF5388
Motif
Other DBs
NCBI-GeneID: 103937111
NCBI-ProteinID: XP_009345305
LinkDB All DBs
Position
Unknown
AA seq 493 aa AA seqDB search
MRRAMAALLLILLSVFVHSNAGEEGFDVRQHLSTASRYGVVKDIADNSFVPSKIPDGCTP
IHLNLVARHGTRAPTKKRIKEMDILASRLEVLLKEAEEQNLSLEKLPGWLKGWKSPWKGK
LTGGELIVQGEDELYDFGIRTRERFPNLFDQDYHPDVYTIKATQVPRTSASAVAFGMGMF
SGKGNLGPGRHRAFAVSSESRATDIMLRFHDCCQNYKAYKKSQEPAVDKLKEPVYDEITS
SLRRRYRLNFTKKDTTSLWFLCKQEASLFNRTDQACALFTPSEVSLLEWADDLEAFILKG
YGKSLNYRMGVPLLEDVLQSMEQAITAEEEKHAPGSYEQARLRFAHAETVVPFSCLLGLF
LDGSEFERTQKEQPLQLPPKPPQKRKWRVNTVAPFGGNNMLVLYSCPANTSSKYFVQVLH
NEHPIPMPGCDGSDFCPLDIFKERIVAPHLKHDYNSVCNAKLEEKEVKPASKLSQLFRWL
FSLGNGDKTLDEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaggagagccatggcggcgcttctgttgatattgttatcggtgttcgtccattcgaat
gccggagaagaaggtttcgatgttcgccaacatctttctactgcgtccagatacggtgtc
gttaaagacattgcggacaactcatttgtaccatctaagataccagatgggtgtactcct
atccacctaaatcttgtggcaaggcatggaacccgtgctcctaccaaaaaacgtatcaaa
gaaatggatatcctggcctctcgtctggaggtgctactaaaagaagcagaagaacagaac
ctgtctttggaaaaacttcctggttggttaaagggttggaaatctccttggaaaggaaaa
ctgacaggtggagaattaattgtccaaggagaggatgaactctatgattttggaatcagg
acacgagaaaggttcccaaatctgtttgatcaggattaccatccagatgtttacacaata
aaggcaacacaggtccctcggacatctgccagtgctgtggcatttggcatgggaatgttt
agtggtaaaggaaatcttggacctggtcgtcatcgagcttttgctgtgtccagtgaaagt
cgtgcgactgatataatgttgaggtttcatgattgttgccaaaactacaaggcatataag
aaaagtcaggagcctgctgttgataagctcaaggaacctgtctatgatgaaattacttct
tcattaaggaggcgctacaggttgaattttacaaagaaggatacaacttctctttggttt
ctttgcaaacaggaagcgtccttgtttaatagaactgatcaagcttgtgcactgttcacc
ccttccgaggtttctttgctggagtgggcagatgatttggaagcctttatattaaaggga
tatggtaaatcattaaactatagaatgggagttccgttgcttgaagatgtattgcagtcc
atggagcaggctattacggctgaagaagaaaaacatgctcctgggagttatgaacaggca
aggctaaggttcgcacatgcagaaactgtagttccattttcatgcctgcttggacttttt
cttgatggatctgaatttgaacggacacagaaggaacagcccttgcaactccctccaaag
cctccccagaagagaaagtggagggtcaatactgtggcaccttttggcgggaataatatg
ctggttctgtacagttgtccagccaacacttcaagcaagtactttgtgcaagtgctgcac
aatgaacaccccattccaatgccaggctgtgatggttctgatttctgtccactcgatatt
ttcaaggaaagaatagttgctcctcatctgaagcacgactataactcagtgtgcaatgca
aaattggaagaaaaggaggtgaagccagccagtaagttatctcaactgttccgttggttg
ttctcactggggaatggtgataaaaccctcgatgaattgtag

DBGET integrated database retrieval system