KEGG   Pyrus x bretschneideri (Chinese white pear): 103940555Help
Entry
103940555         CDS       T03446                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH] 1, chloroplastic-like isoform X1
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00061  Fatty acid biosynthesis
pxb00780  Biotin metabolism
pxb01100  Metabolic pathways
pxb01212  Fatty acid metabolism
Module
pxb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103940555
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    103940555
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    103940555
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pxb01004]
    103940555
Enzymes [BR:pxb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     103940555
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     103940555
Lipid biosynthesis proteins [BR:pxb01004]
 Fatty acid synthase
  Component type
   103940555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 103940555
NCBI-ProteinID: XP_009348967
LinkDB All DBs
Position
Unknown
AA seq 392 aa AA seqDB search
MATTAAPGSHMAAVKRCISSSQRTYMSCTAKFGTNSEVGVWRRLKSSSHISGTQPFSQSL
KSGPAKSVKVVTRAMSGVAENTPLPGLPIDLRGKRAFIAGVADDHGYGWAISKALAAAGA
EILVGTWVPALNIFESSLRRGKFDETRKLPDGSLMEITKVYPLDAVFDSPEDVPEDIKTN
KRYLGSSNWTVKEVVESVKQDFGSIDILVHSLANGPEVTKPLLETSRYGYLAAISASSYS
YVSLLKHFAPIMNPGGASLSLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKHN
IRVNTISAGPLRSRAAKAIGFIDMMIDYSSENAPLQKELSAEEVGNAAAFLASPLASAIT
GTVLYVDNGLNAMGVGVDSPVFENLDIPKAAK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggccacgactgcagctcccggatcacacatggcagcggttaagcgttgcatatcgtcc
tctcaaagaacttatatgtcatgcacagcaaagttcggtacaaacagcgaggtgggagtt
tggagaaggcttaagagttcttcgcacatctcaggaacacagccattctcccagagcttg
aaatcagggcctgcgaaatccgtgaaggttgtcacaagagcaatgtcaggagtagctgag
aacactccactaccaggattgcctattgatttgagaggaaagagagcattcattgctggt
gtggctgatgatcatggatatggatgggcaatatcaaaagctcttgctgctgctggggct
gaaattctagttggtacatgggtgccggcactgaacatttttgagtccagtttaaggcgt
ggaaagtttgatgagacacgcaaactgccagatggctctttgatggaaattaccaaggtt
tacccattagatgcagtttttgacagtcccgaagatgttcctgaagatataaaaaccaac
aaacgctacttggggtcctcaaattggactgttaaggaggttgtggaatccgtgaagcag
gattttggcagcattgatatccttgtccactctcttgccaatgggccagaggttaccaaa
cctcttttggagacgtcaagatatggatatcttgcagctatctctgcatcgagttactca
tatgtttctttactcaagcattttgctccaataatgaacccaggtggtgcttcactctct
ctaacatacattgcttcagaaaggatcattcccggatatggtggagggatgagttcagcg
aaggctgctctagagagtgacacacgtgtgctggcctttgaagctggaagaaagcacaac
attagagttaacacaatatctgcaggaccattaagaagtcgtgcagcaaaggcaattgga
ttcattgatatgatgattgattactcgtcggaaaatgcacccttgcagaaagaactatcc
gctgaggaggtggggaacgctgctgccttcctggcatcgccgttggcatcagctatcacc
ggaactgttctgtatgtggacaatggtctgaatgcgatgggagtcggagttgacagccca
gtttttgaaaaccttgatattccaaaagccgcaaagtaa

DBGET integrated database retrieval system