KEGG   Pyrus x bretschneideri (Chinese white pear): 103941522Help
Entry
103941522         CDS       T03446                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00020  Citrate cycle (TCA cycle)
pxb00190  Oxidative phosphorylation
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
pxb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103941522
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103941522
Enzymes [BR:pxb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103941522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 Thi4 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 103941522
NCBI-ProteinID: XP_009350004
LinkDB All DBs
Position
Unknown
AA seq 633 aa AA seqDB search
MWRCVSRGLGVSSSKRSASTDSLRSYFSRLFSSESATGRSPYTVVDHTYDAVVVGAGGAG
LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
GDQDAIQYMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLDFGKGGQAYRCACAA
DRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMDSEGACQGVIALNMEDGTLHRFQASST
ILATGGYGRTYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLP
PDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDVT
IPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLEKDAGEK
TIAWLDKIRNSNGSLPTSKIRLNMQRIMQNNAAVFRTQETLEEGAQLIDKAWESFHDVQL
KDRSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTTRDDEKWMKHTLG
YWENGKVRLDYRPVHMNTLDDEIETFPPKARVY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtttctcgtgggcttggcgtttcttcctccaagagatccgcctccact
gactctcttagatcttacttctccaggctcttctcctccgaatccgctacaggacgttct
ccgtacactgtggtggaccatacttatgatgcagtggtcgtcggggctggtggtgcgggg
ctgagagcagcaatcggactttcggagcatggatttaacactgcttgcattactaagctt
tttccaactcgttcccacactgttgcagcccagggtggtataaatgctgcattaggaaat
atgactgaggatgactggaggtggcatatgtatgacacagtcaagggaagcgattggctg
ggtgatcaggatgccatccagtatatgtgtagagaggctccgaaagctgtgatcgaactt
gaaaattatggattgccgttttctcgaaccgaagatggaagaatatatcaacgtgcattt
ggtggtcaaagtcttgactttggaaaaggtggacaggcataccgctgtgcttgtgctgct
gacagaactgggcatgctctattgcatactctctatggacaagcaatgaaacataataca
caattttttgttgaatacttcgctttggatcttttgatggacagtgagggggcctgccaa
ggagtcattgcattaaatatggaggatggaactttacatcggttccaagcatcatcaaca
attttggccacagggggttatggtagaacatacttttctgcaacctcagcacatacctgc
actggagatggtaatgcaatggttgcacgtgctggcctcccgcttcaggatttggagttt
gtgcagtttcaccctactggtatatatggtgctgggtgcctcattactgaaggatcacga
ggggaaggtggtatccttaggaatagtgaaggtgagcgatttatggaacgatatgcccct
acagcgaaagatcttgcttctagggatgttgtgtcgagatctatgactatggaaatccga
gagggtcgtggtgtaggacccttgaaggaccacatctatctccacttgaatcatttgccc
ccagatgtactcaaggagaggcttcctggtatctccgaaactgctgccattttcgctggt
gtggatgttacaaaggagcctattcctgtcttacctactgtgcactataatatgggtgga
attccaacaaattaccacggagaggtagttaccattaaaggtgatgatccagatgtaaca
attcctgggttaatggcagctggggaggcagcctgtgcatctgttcacggtgccaatcgg
cttggtgcaaattcactccttgacattgttgtttttggtcgagcttgtgcaaatagagtt
gcagagatccataaaccaggggagaaacaaaagcccctggaaaaggatgctggagagaag
accattgcatggttggacaaaataaggaattcaaacggctcattgccaacttcaaaaatc
cggttgaatatgcaacgaataatgcaaaataatgctgctgtgttccgcacacaagaaaca
ttagaagaaggtgctcagttgattgacaaggcatgggagagctttcatgatgttcaattg
aaggatcggagtttgatatggaactctgacttgatagagaccatagagttggaaaacctt
ttgataaatgcctgtatcaccatgcattccgctgaagccaggaaagaaagcagaggagca
catgcgcgtgaagatttcacaacaagggatgatgagaaatggatgaaacatacactggga
tactgggaaaatgggaaggtccgactagactacagaccggttcacatgaacacattggat
gatgaaatcgagacgttcccacctaaagctcgtgtctactga

DBGET integrated database retrieval system