KEGG   Pyrus x bretschneideri (Chinese white pear): 103942503Help
Entry
103942503         CDS       T03446                                 

Definition
(RefSeq) elongation factor Tu, mitochondrial-like
  KO
K02358  elongation factor Tu
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pxb03012]
    103942503
   03029 Mitochondrial biogenesis [BR:pxb03029]
    103942503
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pxb04147]
    103942503
Translation factors [BR:pxb03012]
 Eukaryotic Type
  Elongation factors
   103942503
 Prokaryotic Type
   103942503
Mitochondrial biogenesis [BR:pxb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    103942503
Exosome [BR:pxb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103942503
  Exosomal proteins of breast cancer cells
   103942503
  Exosomal proteins of colorectal cancer cells
   103942503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D2 GTP_EFTU_D3 MMR_HSR1 Pan3_PK
Motif
Other DBs
NCBI-GeneID: 103942503
NCBI-ProteinID: XP_009350963
LinkDB All DBs
Position
Unknown
AA seq 465 aa AA seqDB search
MATISFAKSLVNPALKLVLKQSQYTHLRNTVGLPSITPFSIVLRRNYAEKQVFERNKPHC
NVGTIGHVDHGKTTLTAAITKVLSDLDLAQSKGYADIDNAPEEKARGITINVAHVEYQTE
TRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGVMPQTREHLLLAKQIGIEHVVV
FINKVDAADQEMVELVEMEIRELMTEMGYDGDKIPVVKGSALCALEGKSPDIGSNAITEL
LKEVDSFIPTPVRELDKPFLMPVESVHSIPGRGTVITGRLYRGTLKKGTECEIVGHGKVM
KTTVTGVEMFHKTLEEAQAGDQLGALVRSIKREQIKRGMVMAKPGTAKAFDNIEAAVYIL
SKEEGGRSKPFTSFIQLQMFSMTWDCATQVTIPDKEMVMPGEDAKLQLKLMKPMVCEAGQ
RFTLRMGDMTLGTGVITKINNNLSEEDRMKLTEGKKAREKASSKK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgatatcatttgccaaaagtttggttaacccagctttaaaactggtattaaaa
cagagccagtacacacatctcagaaacactgttggcctccctagcatcactcccttcagt
attgtgctgcgaagaaattatgcggaaaaacaagtatttgagagaaataagcctcattgc
aacgtcggtaccattggacacgtcgatcatggaaagaccaccttaacagcagccattacc
aaagtattatcagaccttgacttagctcagagcaaaggttacgcagacattgacaatgcc
cctgaagagaaggctcgaggtatcaccatcaatgttgctcacgttgagtaccagactgaa
accagacattatggacacacagactgcccagggcatgctgattacattaagaacatgatc
acaggaacagcacagatggacggagcaatcctcgtggtagctgccacagacggagtcatg
ccacagaccagagagcacttgctgcttgccaaacagattggcattgagcatgtggtggtg
ttcatcaacaaggtggacgccgctgaccaggagatggtggagctcgttgagatggagatc
agggaactgatgaccgagatgggctatgatggagacaaaatcccagttgtcaaaggctca
gctctctgtgccctcgaaggcaagagcccggacatcgggtctaacgctatcacggagctg
ctgaaggaggtggactcgttcatcccgacgccggtgcgcgagctggacaagcccttcctg
atgcccgtggagtccgtgcactctatccccggacgagggaccgtcatcactggaagacta
tacagaggcacactgaagaagggcacggaatgcgagatcgtgggccacggcaaggtcatg
aagacgaccgtcaccggcgtggagatgttccacaagaccctggaggaggcgcaggccgga
gaccagctcggggccctcgtccgctccatcaagagagagcagatcaagcgaggcatggtc
atggccaagcccggaactgccaaggcctttgacaacattgaagccgcagtctacatcctg
agcaaggaggagggaggccgctccaagcccttcacctctttcatccagctgcagatgttc
tctatgacctgggactgcgccactcaggtcaccatccctgacaaggaaatggtcatgccc
ggtgaagatgccaaactgcagctgaaactcatgaagcccatggtgtgcgaggccggccag
aggttcacgctgcgcatgggagacatgaccctcggcaccggagtcatcaccaagatcaac
aacaacttgtctgaagaagacaggatgaagctcaccgaaggaaagaaggccagggagaag
gcctcgtcgaagaagtga

DBGET integrated database retrieval system