KEGG   Pyrus x bretschneideri (Chinese white pear): 103945100Help
Entry
103945100         CDS       T03446                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00052  Galactose metabolism
pxb00500  Starch and sucrose metabolism
pxb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103945100
   00500 Starch and sucrose metabolism
    103945100
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103945100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103945100
NCBI-ProteinID: XP_009353898
LinkDB All DBs
Position
Unknown
AA seq 912 aa AA seqDB search
MKTKRSSNPPKPLYHHLHLHLPFFFFSSIFCLLSSAKAIAEAEAKAAVGYGYKIQSVHYD
SSGNSLTANLGLIKSSSLYGSDIPNLNLHASYETKDRLRIRIADSKKQRWEVPQDMIPRQ
TKTPTPHHHCISHDLFFTLRNTTPFGFTVARCSSNDVIFDTSPHSSDPNTFLVFKDQYIQ
LSSSLPHNRSSIFGLGEHTKSSFKIIPNQTLTLWNADIGSVNPDVNLYGSHPFYLDVRSA
SQAGGKTGAGTSHGVLLLNSNGMDITYSGDRITYKVIGGIVDLYFFAGPTPELVVEQYTE
LIGRPAPMPYWSFGFHQCRWGYKNVSDLEGVVAGYTKAGIPLEVMWTDIDYMDAYKDFTL
DPVNFPLDKMKKFVSTLHQNGQKYVLILDPGISNNDTYETYIRGKEADIFIKRDGIPYLG
NVWPGDVYYPDFAHPESEKYWANEMQIFQKALPFDGLWLDMNELSNFRTSPPTPSSTLDD
PPYKVNNSGVLRPINNNTVPASALHFGNITEYNAHNLYGLLEAKATSNALINVTGKRPFI
LSRSTFVSSGKYTAHWTGDNSARWSDLAYTIPGILNFGLFGVPMVGADICGFSGDTTEEL
CRRWIQLGAFYPFSRDHSEKFTIRQELYLWDSVAATSRKVLGLRYRLLPLFYTSMYEAHK
KGTPIARPLFFSFPQDITTYEINTQFLIGRGVMVSPVLKPGVNSVDAYFPAGNWFDIFNY
SKSVSVSSGQHVRLDAPPDHINVHVCEGNILALQGKALTTQAARKTAFELLVVVSSNRQS
TGEVFVDDGEEIEMGGEGGKWSLVRFYSGTENGTVFVSSKVVNGGFALSEKWIIDKVTFI
GLEKVGHGLEGCAFNITKGANLNANSDIRASFDSNKQFVTVVISDISILIGSEFKLELKP
KHATESTLQRRN
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaagagatcatcaaatccaccaaaaccattgtatcatcatctgcatctgcat
ctgccattcttcttcttctcgtctattttctgtcttctatcatctgcaaaagcaattgca
gaagcagaagcaaaagcagcagttgggtatggatacaaaattcaatccgtccactatgat
tcctccggaaactcattgactgctaatcttggcctcatcaagtcctcctccctctacgga
tctgacatcccaaatctcaaccttcacgccagctatgaaaccaaagatcgtctaagaatt
cgaatagcggactcaaagaagcaaagatgggaagtcccacaagacatgatcccccgccaa
accaaaacccccaccccccaccaccactgcatctcccacgaccttttcttcactctccgc
aacaccaccccattcggcttcaccgtcgcccgctgctcctccaacgacgtcatcttcgac
acctccccccactcgtcagaccccaacaccttcttggtcttcaaggaccaatacatccaa
ctctcctcctctctcccccataacagatcctccattttcggcctcggcgagcacaccaag
tcctccttcaagatcattcccaatcagacattgactctctggaatgccgacattggtagc
gtcaatcccgacgtcaacctttacgggtcccaccccttctacctggacgtcaggtcggcg
tctcaagctggcggcaagaccggtgctggaacatctcatggagtgctgctgctgaatagc
aatggcatggacataacatacagcggtgataggattacttataaggtcatcggtggaatt
gtggacttgtacttctttgccgggccgacacctgagttggtagtggagcagtatacagaa
ctaatcggccgccctgcccctatgccctactggtcttttggattccaccagtgtcgatgg
ggttacaagaatgtttcggatcttgagggcgtggttgctggttatacaaaagccggcatc
cctcttgaagttatgtggacggacatcgattacatggatgcttacaaggacttcactctc
gatcccgtcaactttccattggataagatgaagaaatttgtaagcactcttcaccaaaat
ggtcagaaatatgtcctcatcttggaccctggtattagtaataatgacacctatgaaacc
tacatcagagggaaggaagcagatattttcatcaaacgcgacggaattccttacctggga
aatgtatggcccggcgatgtgtactacccagactttgcacatccagaaagtgaaaaatat
tgggctaatgagatgcaaatatttcaaaaggctctgccttttgacggtctttggctcgat
atgaatgagctatccaatttcagaacctcccctcccactccatcttctacacttgatgac
cctccttacaaggttaacaattctggagtcctgcgtccgatcaataacaatactgttccg
gcatcagcgctgcactttggtaacattacagaatataatgcacataatttgtatggactc
ttggaagccaaggcaacaagcaacgccttaatcaatgtaactggtaaaagaccgtttata
ctttctagatcgacttttgtaagctccggtaagtacacagcacactggactggtgacaat
tctgcacgatggagtgatctggcatatacaattccaggcattttaaattttggacttttc
ggagttccaatggttggagctgacatatgtggattctctggagatactaccgaagaactc
tgccggcgatggattcagcttggggccttttaccccttttcaagagatcactccgaaaag
tttacaatccgtcaagagctctatctatgggactcagtggcagcaacatccaggaaggtg
cttgggctgcgctaccggttgctccccttattttacacatcaatgtatgaggcacacaaa
aagggaaccccaattgcaagaccccttttcttttcatttcctcaagatatcacaacttac
gagatcaatacgcagtttctaattggtcgaggtgtaatggtctcacctgtactgaaaccg
ggagtcaattcagttgatgcatattttcctgctggaaactggtttgatatcttcaactac
tcaaaatctgtaagtgtaagttcaggacagcacgttaggttggatgcgccgcctgatcat
atcaatgtgcatgtttgtgaaggaaatattttggcattgcaaggaaaggccttgacaaca
caagcagcccgaaagactgctttcgagcttttggtggtcgttagcagtaacagacaaagt
acaggagaagttttcgtggacgacggagaggaaattgaaatgggaggagagggaggcaag
tggagtttagtgagattttatagtggaacagaaaatggaactgtatttgtaagctcaaag
gttgtaaatggaggattcgctttaagtgaaaaatggatcattgataaagttaccttcatt
gggttggaaaaggttggtcatggattggaagggtgtgcattcaacattactaagggagca
aatttgaacgcaaactcggatatcagagccagctttgacagtaacaagcagtttgtcaca
gtagtgatttccgacatatcgattcttataggatcagagtttaagttggagctgaagccg
aagcacgctaccgaaagcactttgcagagaagaaactga

DBGET integrated database retrieval system