KEGG   Pyrus x bretschneideri (Chinese white pear): 103946162Help
Entry
103946162         CDS       T03446                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103946162
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pxb03036]
    103946162
Enzymes [BR:pxb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103946162
Chromosome and associated proteins [BR:pxb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103946162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 103946162
NCBI-ProteinID: XP_009355081
LinkDB All DBs
Position
Unknown
AA seq 689 aa AA seqDB search
MEGGSSQNFVPPSAGFDKSRVLDVRPLRSLMPVFPAASQAPSFPGMPPFGNTPNGFPPFY
PFGLPPSYQASPDLNSEMRTPTSPMPAPIRSYRAPASSGADDFPEDSNGDGYFDPHVGSS
SSRKKTTKASSYRKKTKKNGDGDSLTNNGSGVTFVSVMSSFQIEDGNRELVNYVLMNFDA
LRRRICQIEDNKESKTGVIKRADLKAGGIVMSKKVRTNMRRRVGVIPGVEIGDIFFFRME
MCAVGLHAPSMAGIDYMTGNGDGDKDPVALSIVSSGGYDDEAEASDVLIYSGQGGNSNSK
DKDREVADQKLERGNLALQRSLHHGNEVRVIRGVKDDVSSTIKIYVYDGLYKVHESWTER
GKAGCNIFKYKLLRVPGQPPAFAVWQAIRKWKDGFSSRAGLVLQDLTSGTEPVPVSLVNE
VDNEKALVSFTYFPTLKYTKSFSLMPPSFGCNCRSACQPGDTNCSCIQKNGGDFPYTSNG
ILVSRKQLLHECGPTCPCTPNCKNRVSQTGVKLRLEVFKTKDRGWGLRSWDSIRAGAFIC
EYAGEVIDEAKLKQKEEGGENDEYIFDTGRDYESFKWSYEPGLIEESPNDVEEYNIPYRL
IISAKNVGNVGRFINHSCSPNVFWQPVVYEHNNQSFVHIAFYAIRHVPPMTELTYDYGSS
SSNEAGSNSGPNRKNKCLCGSSKCRGYFG
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggaaggagggtccagccaaaacttcgttcctccttcagctgggtttgataagtcaagg
gttttggatgttagacctttgcgtagtttgatgccggtgttcccggctgcgtctcaggcc
ccatcctttccgggcatgcctccctttggcaatacccctaatgggtttcctccattttac
ccatttggtttaccgccaagctaccaggcctcacctgatctaaatagtgagatgaggacg
ccaaccagtcccatgcccgctcctatccggtcatatagagccccagcctcatctggcgcc
gatgactttccagaggattccaatggagatgggtactttgatcctcatgtaggttctagt
tcgtctcgaaagaagaccacaaaagctagttcatatcggaagaagaccaagaaaaatgga
gatggtgattcgttaacaaacaatgggtcaggtgtgacctttgtttctgttatgagttca
tttcaaattgaagatggtaacagggagttggttaattatgtgctcatgaattttgatgca
ctccggagaaggatatgccagattgaagataacaaggaatcgaaaactggcgttattaag
cgtgcagatttgaaagctggtggcatcgtgatgagcaaaaaggttcggacaaacatgagg
aggagagttggggttatccctggagttgagattggcgacattttctttttccgaatggaa
atgtgtgcggtcggattacatgctccatctatggctggaattgactacatgactggcaat
ggtgatggtgacaaagatccagtggccttaagcattgtatcttcagggggctatgatgat
gaggcagaggccagcgatgtcttgatatacagtggtcagggtggaaatagcaacagcaaa
gacaaagatagggaggttgctgatcagaagcttgaaaggggtaatcttgctcttcagaga
agcttgcatcatggaaatgaagtacgagtgattcggggcgtgaaagatgatgttagttca
acaataaagatctatgtctatgatggcctatataaagttcatgagtcatggacagagagg
gggaaagctggttgcaatatattcaagtacaagttgttgagggtgcctggacagccacca
gcttttgctgtttggcaagctattcgtaagtggaaggatggtttttcctcaagggctgga
cttgttcttcaagacctcacttcagggactgaacctgtacctgtttcccttgtaaatgag
gttgataatgagaaggcgctggtttctttcacttatttccctacgctcaaatatactaag
tcattcagtctaatgccaccttcttttggatgcaattgccgcagtgcatgccagccaggt
gatacgaattgctcttgcattcagaaaaatggaggtgattttccttatactagcaatggg
attctagtcagccgtaaacaattgttacatgaatgtggtcctacgtgtccatgcactccc
aactgcaaaaaccgagtatcccaaactggtgtaaaattgcggctggaagtgtttaagaca
aaggataggggatggggcctccggtcatgggattctattcgtgctggtgcttttatttgt
gagtatgctggtgaggttatagatgaagcgaagttaaaacagaaagaggagggaggggaa
aatgatgaatatatttttgacacaggccgtgattatgaatcattcaagtggagttatgaa
cctggattaatagaggagagtcctaatgatgttgaggagtataacattccatatcgcctg
atcataagtgccaagaatgttgggaatgtaggtcggttcattaatcacagctgctcacca
aatgttttttggcaaccagttgtatatgagcacaacaatcagtcttttgtccatattgct
ttttatgccatcagacacgttcccccgatgacagagttgacatatgattatgggagttca
agctctaatgaagctggcagtaacagtggacccaacaggaagaataaatgcttatgtgga
tcgtcaaaatgccggggttattttggttga

DBGET integrated database retrieval system