KEGG   Pyrus x bretschneideri (Chinese white pear): 103946880Help
Entry
103946880         CDS       T03446                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00250  Alanine, aspartate and glutamate metabolism
pxb00410  beta-Alanine metabolism
pxb00430  Taurine and hypotaurine metabolism
pxb00650  Butanoate metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Module
pxb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103946880
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103946880
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103946880
   00430 Taurine and hypotaurine metabolism
    103946880
Enzymes [BR:pxb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103946880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 GST_C_6 Perilipin
Motif
Other DBs
NCBI-GeneID: 103946880
NCBI-ProteinID: XP_009355970
LinkDB All DBs
Position
Unknown
AA seq 505 aa AA seqDB search
MAISTTSGDRLGELVNCTFASRYVRNDLPKFQMPATSIPKDAAYQIINDELMLDGNPRLN
LASFVTTWMEPECDRLMMASMNKNYVDMDEYPVTTELQNRCVNMIANLFNAPIGDGETAV
GVSTVGSSEAIMLAGLAFKRKWQHKRKREGKPSDKPNIVTGANVQVCWEKFARYFEVELK
EVKLSEGYYVMDPTKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLAQKNKQTGWDT
PIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRSKEDLPDE
LVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNVMINCMENTRLLREGLE
KTGRFEILSKDIGVPLVAFSLKDSSKHTVFEVADSLRKFGWIVPAYTMPANAEHVAVLRV
VIREDFSRGLAERLVSDIDKVMREIDTLPSHVSSKIAHVTATVDEVVSGSKGVVKPIVHK
SATEIEQQVVSRWKEFVNGRKTGVC
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctcaacgacatccggtgaccgtcttggagagctggtgaactgtacctttgct
tccagatatgtgcgtaacgacctccctaagtttcagatgccggcgacgtcgataccaaag
gacgcggcgtatcagataataaacgatgagctcatgctggacgggaatccgcggctgaac
ttggcgtcgttcgtgacgacgtggatggagcccgaatgcgatcggctgatgatggcttcc
atgaacaaaaactacgtcgacatggatgagtaccctgtcaccactgaactccagaatcgg
tgtgtgaatatgatcgcaaatctgtttaatgctcccattggagacggcgaaactgccgtt
ggtgtgtcaacagtgggttcttcagaggcaataatgttggcaggtctagctttcaaaagg
aagtggcaacacaagagaaaacgagagggaaagccttctgataagcccaacatagtcact
ggagctaatgtgcaggtttgttgggaaaaattcgcgaggtattttgaagttgagctgaag
gaggtgaagctttcggagggatactatgtgatggaccctacgaaagctgttgagatggtt
gatgagaatactatctgtgttgctgctattctaggctcaaccctaacaggagagttcgaa
gacgtgaagctccttaatgatctccttgctcaaaagaataagcagacgggatgggatact
cccattcatgtcgatgctgccagcggaggctttattgctccgtttctgtatcctgagctc
gagtgggatttccgcttgccgttagtcaagagcatcaatgtgagtggccacaagtatggc
cttgtatatgccggtgttggatgggttgtgtggaggagtaaggaggacttgccggacgag
cttgtgtttcacatcaattaccttggatctgatcagcccactttcaccctcaacttttct
aaaggttctagccagataattgctcagtattatcagttcattcgactaggttttgagggt
tacaaaaatgtgatgataaactgcatggagaatacaagattgctgagagaaggactagag
aaaacagggcggtttgaaatactctccaaagacataggagtgccccttgtggcattttct
ctaaaagacagcagcaagcacactgtgttcgaggtagccgatagtttgaggaagttcgga
tggatagttccagcctacacgatgccagccaatgcagaacatgtagctgttcttcgcgtg
gttattagggaggatttcagcaggggtttggcggagaggctcgtctcagacattgacaaa
gttatgagggaaatagacacactcccgagccacgtgtctagcaaaatcgcccatgtcacg
gctactgtcgacgaagtagtcagcggcagcaagggggttgtgaaacctattgttcataag
agtgcgacagagattgagcaacaggtagtgtcgcgctggaaggagtttgtgaatgggaga
aaaacaggcgtatgctag

DBGET integrated database retrieval system