KEGG   Pyrus x bretschneideri (Chinese white pear): 103947462Help
Entry
103947462         CDS       T03446                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00010  Glycolysis / Gluconeogenesis
pxb00020  Citrate cycle (TCA cycle)
pxb00620  Pyruvate metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
pxb01200  Carbon metabolism
Module
pxb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103947462
   00020 Citrate cycle (TCA cycle)
    103947462
   00620 Pyruvate metabolism
    103947462
Enzymes [BR:pxb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     103947462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 103947462
NCBI-ProteinID: XP_009356646
LinkDB All DBs
Position
Unknown
AA seq 482 aa AA seqDB search
MALSPFLSKTPISFSSSISTSLPWRPSPFSSSSSTAFRSNPRRRTLTVHSKIREIFMPAL
SSTMTEGKIVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGETAPVG
AAIGLLAETEEEVAEAREKAKSPSSGLAASSSPAEAAVTPTPPPATATPAPAIAQPAPSA
TATYTPKKGVATPFAKKLAKQHKVDIATVVGTGPFGRITPADVEAAAGIVMPTKPVAAEP
TSVAAAPPKPSAAPPPLLPGSTVVPFTTMQAVVSKNMVESLSVPIFRVGXPINSDAIDAL
YEKVKPKGVTMTALLAKAVAMALAQHPVVNASCKDGKSFLYNSSINIAVAVAINGGLITP
VLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYSTGTFTLSNLGMFGVDKFDAILPPGQ
GAIMAVGASQPTVVADADGFFSVKSKMLVNVTADHRIVYGADLAAFLKTFAKIVENPESL
TL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgtctcctttcctctccaagaccccaatttccttctcctcctccatctccacc
tccctcccatggcgcccctcccccttctcctcatcctcctccaccgcatttcgctctaat
ccccgccgccgcacccttaccgtccactccaaaatcagggagatcttcatgcccgccctc
agctccaccatgaccgagggcaagatcgtctcctgggtcaaatccgagggcgacgtcctc
tccaaaggcgagagcgtcgttgtagtcgagtctgacaaagccgacatggacgtcgagacc
ttctacgacggcattctcgcggcaatcgtcgttggggaaggcgagaccgcccccgtcggc
gccgccatcgggcttctcgctgagaccgaagaggaagtcgccgaggccagggaaaaagcc
aaatccccctcgtctggtcttgccgcttcttcctccccagctgaagctgctgttacgccc
actcctcctcctgctactgccactcccgcccctgccattgcccagcctgctccatctgca
actgctacttacactcccaaaaagggcgtggccactcctttcgcaaaaaagctagccaag
cagcacaaggtcgacattgccaccgtggtgggcaccggcccatttggccgaattacccct
gctgacgtggaggcggctgccggaattgtcatgcccacgaaacctgtcgccgccgagccc
acttcggtggccgctgctccacccaagccttctgctgcacccccgccactgcttcccggg
tcaaccgtggtgccatttaccacaatgcaggccgtcgtctcgaagaacatggtggaaagc
ctctccgtgccgattttccgggtagggtaaccgattaacagcgatgccatcgacgccctc
tatgaaaaggtgaaaccaaagggtgtgacaatgactgcattgttggccaaggctgttgct
atggcacttgctcagcacccagttgtgaatgcgagctgcaaagacggaaagagctttttg
tataacagcagcataaacattgctgttgctgtggcaatcaatggaggactcataacccct
gttcttcaggatgccgataagttggatttgtatttgctgtcccagaaatggaaggagtta
gtggagaaggcccgttccaagcaacttcagccccatgagtacagtacaggaactttcacc
ttgtccaatttgggcatgtttggagtggacaagtttgatgctattcttccaccaggccag
ggggctatcatggctgttggagcttcacagccaactgttgtggccgatgcagatggattc
ttcagtgtaaaaagtaaaatgctcgtgaacgtaacagctgaccaccggattgtttatggt
gctgatttggctgccttccttaagacatttgccaagattgttgagaacccagagagcctc
acattgtag

DBGET integrated database retrieval system