KEGG   Pyrus x bretschneideri (Chinese white pear): 103947719Help
Entry
103947719         CDS       T03446                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103947719
Enzymes [BR:pxb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103947719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu Cu_amine_oxidN2
Motif
Other DBs
NCBI-GeneID: 103947719
NCBI-ProteinID: XP_009356939
LinkDB All DBs
Position
Unknown
AA seq 219 aa AA seqDB search
MQAALAVMAAQTVLLSSPTLFSQLQIPNPHSISPSSFHGVTLKLPLKSQSMSFAAAAPKP
LTVVAATKKAVSVLKGTSSVEGVVTLSQENDGPTTVNVRITGLTPGPHGFHLHEYGDTTN
GCISTGPHFNPKQLTHGAPEDEVRHAGDLGNIVANADGVAEATIVDNQIPLTGPNAVIGR
ALVVHELKDDLGKGGHELSLSTGNAGGRLACGVVGLTPV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagctttggccgtcatggcagctcagactgtcttgctttcatcccccactctc
ttctcccaactccaaatccctaaccctcactcaatttctccttcctccttccatggcgtc
accctcaagctcccactcaaatcccaatccatgtctttcgccgccgccgcccctaagcct
ctcactgtcgtcgccgccaccaagaaagccgtctctgtcctcaagggcacttccagtgtg
gaaggagtcgtcaccttgagccaagaaaacgatggtcctacaaccgtgaatgttcgtatt
actggacttactcccggtcctcatgggtttcacttacatgagtatggtgatacgacaaat
ggatgcatatccacaggaccacatttcaatcctaaacagttgacacatggtgctcctgag
gatgaagtccgtcatgcgggcgacctgggaaacatagttgctaatgccgatggggtggca
gaggcaacaatcgtggataaccagataccattaactggtcctaatgctgtaattggaaga
gcacttgttgttcatgagcttaaggatgaccttggaaagggtggacacgaacttagtcta
agcactggcaatgcaggcggaagattggcatgtggcgtggttggtttgacaccggtgtaa

DBGET integrated database retrieval system