KEGG   Pyrus x bretschneideri (Chinese white pear): 103947929Help
Entry
103947929         CDS       T03446                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00620  Pyruvate metabolism
pxb00710  Carbon fixation in photosynthetic organisms
pxb01100  Metabolic pathways
pxb01200  Carbon metabolism
Module
pxb_M00168  CAM (Crassulacean acid metabolism), dark
pxb_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
pxb_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
pxb_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    103947929
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103947929
Enzymes [BR:pxb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     103947929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 103947929
NCBI-ProteinID: XP_009357178
LinkDB All DBs
Position
Unknown
AA seq 967 aa AA seqDB search
MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGESLRETVQDC
YELSAEYERKQVPQKLEELGKMLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK
LKKKGDFADEASATTESDIEETLKRLVGDLKKSPEEIFDALKNQTVDLVLTAHPTQSVRR
SLLQKHARIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYFSQIEDLMFELSMWRCNDELRARADELHRSSKKDAKQYIEFWKKI
PPNEPYRVILGDVRDKLYNTRERARQLLANGVSDIHEDTTFTNVEQFLEPLELCYRSLCS
CGDRVIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVINAITKHLEIGSYREWSEER
RQEWLLSELRGKRPLFGRDVPKTEEIADVLETFHVISELPSDNFGAYIISMATAPSDVLA
VELLQRECGVKKPLRVVPLFEKLADLEAAPATVARLFSIDWYKNRINGKQEVMIGYSDSG
KDAGRLSAAWQLYKAQEELIKVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVIAT
KEYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFKHAVEKDAKNLQMLQEMYNQWPFFRVTIDLIEMVFAKGDPGIASLYD
KLLVSKDLWSFGDRLRSNYEETKRLVLQVAGHRALLEGDPYLRQRLLLRDSYITTLNVCQ
AYTLKQIRDPNYHIKVRPHLSKEYMETRSKPAAELVKLNPTSEYAPGLEDTLILTMKGIA
AGMQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaggaacttggagaagatggcttcaattgacgcacagctgaggcttttggca
cctgggaaggtctctgaggatgacaaactggttgagtacgatgctctgctattggatcgc
ttccttgatattcttcaggatttacatggagagagtctcagagaaacggtgcaagattgt
tatgagctttccgcggaatatgaaagaaagcaggtccctcaaaagttggaggaacttggc
aaaatgctaacgagtttggatcccggggactccattgtcattgcaaaatccttttctcac
atgcttaacttggcaaatttggccgaggaagttcagattgcgtaccggaggaggatcaag
ttgaagaagaagggagattttgctgatgaggcgtcggctactacggagtcagacattgaa
gagactctcaagaggcttgtgggggacctgaaaaagtccccagaagaaatttttgatgcc
ctgaagaaccagactgtagatttggttctgactgcacatcctactcagtctgttcgcagg
tctttgcttcaaaagcatgcaaggataagaaattgtttgacgcagttgtatgctaaggac
attacgcctgatgataagcaggaactcgatgaggctttacaaagggagattcaagctgca
tttcgtacagatgaaatccgaaggactcctccaacccctcaagatgagatgagggcagga
atgagctacttccatgagacaatttggaaaggtgtaccaaaattcttacgtcgtgttgac
actgctttgaagaacatagggataaacgaacgtgttccttacaatgcccctctcattcag
ttttcttcttggatgggtggggatcgtgatggaaaccccagggtcactcctgaagttact
cgggatgtatgcttattggctagaatgatggctgctaacttatacttctcccagatagag
gatcttatgtttgagttatctatgtggcgatgcaatgatgagcttcgcgctcgtgctgat
gaacttcataggtcttcaaagaaggatgcaaaacagtacatagagttttggaaaaaaatt
cctccaaatgagccttatcgtgttattcttggtgatgtaagagacaagctttacaatacg
cgtgaacgtgctcgccaattattagccaatggagtctctgacattcatgaggacacaacg
tttaccaatgttgaacagtttctggagcctctggaactttgttaccggtcactctgctcc
tgtggcgatcgagtaattgctgatggaagccttcttgatttcttacgacaagtttctact
tttgggctgtctcttgtgagactagacatacgacaagaatcagacaggcacactgatgtc
atcaatgctataacaaaacacctggagatagggtcttatcgagaatggtctgaggagcgt
cggcaagaatggcttttgtctgagcttcgtggcaagcgccccctctttggccgtgatgtt
cccaagactgaagaaattgctgatgtgctggaaaccttccatgtcatttctgaacttccc
tcagacaattttggtgcttatattatatcaatggcaacagccccatctgatgttctcgct
gttgagcttttacaacgtgaatgtggtgtgaagaagccactgagggttgttccattgttt
gagaagcttgctgatcttgaggctgctcctgctactgtggctcgtctcttttcaatagac
tggtacaaaaatcggatcaatgggaagcaagaagtcatgatagggtactcagattccggg
aaggatgctggtcgtttatctgcagcatggcagttatacaaggctcaggaagagctcata
aaggttgcaaaacaatttggggttaagcttacgatgtttcatggtcgaggtggaacagtt
ggaagaggaggggggcccacccatcttgctatattgtctcagccacctgacactattcat
ggttcgcttcgtgttacagttcaaggtgaagttattgaacaatcatttggggaggaacac
ttgtgctttagaacactccagcgtttcacagcagctacacttgagcacggaatgcatcct
ccagtctccccaaagccagaatggcgtgcactcatggatgaaatggccgtcattgcaaca
aaggaatatcgttcaatagttttccaggagccccgttttgtggaatactttcgcctcgca
acaccggagttggagtatggtcgaatgaacattgggagtcgtccttcaaaacgaaagccc
agtggaggcattgaatcacttcgtgcaatcccatggatctttgcttggacccagacaaga
tttcacttaccagtgtggcttggcttcggggcagcatttaagcatgctgttgagaaggat
gcaaagaatcttcaaatgctccaggagatgtataaccagtggccttttttcagagtcaca
attgatttaattgagatggtatttgccaagggcgatccgggtattgcctctctctatgac
aagcttcttgtgtcaaaagacctgtggtcatttggagaccgattgaggtccaactatgaa
gaaactaagcgcctcgtcctccaggttgctggacatagggctcttctggaaggagatcct
tatttgaggcagcgactcctccttcgtgattcatatatcacaacacttaacgtgtgccaa
gcctatacactgaagcagattcgtgatccaaactaccatattaaagtaaggccacacttg
tcaaaggagtacatggaaacaagaagcaagccggcagcggagcttgtgaaactcaatcca
acgagcgagtatgctcctggtctagaggacacgcttattctgaccatgaagggtattgct
gctggcatgcagaacaccggttga

DBGET integrated database retrieval system