KEGG   Pyrus x bretschneideri (Chinese white pear): 103953005Help
Entry
103953005         CDS       T03446                                 

Definition
(RefSeq) DNA cross-link repair protein SNM1
  KO
K15340  DNA cross-link repair 1A protein
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pxb03400]
    103953005
DNA repair and recombination proteins [BR:pxb03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Nucleases
    103953005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DRMBL SAM_1 SAM_2 Lactamase_B_2 Lactamase_B La
Motif
Other DBs
NCBI-GeneID: 103953005
NCBI-ProteinID: XP_009363003
LinkDB All DBs
Position
Unknown
AA seq 727 aa AA seqDB search
MSSKSQPFSSTRFNSMIAAAADDDDDFQIPLTQTATAPKPSKKQKRSKPIYRGKENIPPN
CFGSKDSTLEQTQGFKSSIFECSLDSIPTNFDCGTLDGGGLASSSSACVDEEKENEKGLK
SKGGYLCNSIESRLIKPRPDWDFGSGDGESQDFEELDVLLKLCNRAGGGESVGVNGMEKG
FGIVEDENGGLVLCPLCGADISDLSNEERQVHSNECLDEEEVQAQDAPCPDEERGHQNSG
HVLEWLRSLGLEKYKDVFVREEIDWDTLQWLTEEDLFSIGITALGPRKKIVHALAQLREG
ATTTTSSSTEAQPRKRRANGVDMPNDASEAPVNDVSKTAANKLITDYFPGFGTARKQVCT
TSREQRRVEKRVPRSGQKRGVENNNATNRKLRDIPSWCCIPGTPFRVDAFKYLRRDCSHW
FLTHFHMDHYQGLTKSFCHGKIYCSSITAKLVNMKIGIPWDSIQVVPVNHKMNISGINVT
CLDANHCPGSIIILFEPPDGKAVLHTGDFRYSNSAASMSFLQTCSIHTLILDTTYCNPQY
DFPKQEAVIQFVIDAIQAETFNPKTLFLIGSYTIGKERLFLEVARVLRKKIYVNAGKLHT
LKCLDFPEEDMQWFTLNEQESHIHVVPMWTLASFKRLKHISNQYSSRFSLIVAFSPTGWT
FGKGKKKSPGRRSQQGTVIRYEVPYSEHSSFTELREFVKLVSPVEIIPSVNNHGPDSAKA
MVSLLSS
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcaaagtcccagcctttctcttccaccagattcaactcaatgatcgccgccgcc
gctgacgacgacgacgactttcagatcccactcacccaaacagccacagctcccaagcct
tccaaaaagcagaagcgctccaaacccatctatcgcggcaaggagaacattccccccaat
tgtttcggcagcaaagactcgactttggagcagacccagggtttcaaatcctcgattttc
gagtgcagcttggattcgatacccacaaacttcgattgcgggacccttgacggtggcggt
ctcgcttcttcttcttctgcgtgcgttgacgaggaaaaggaaaacgaaaaggggttgaaa
tcaaaagggggatatctgtgcaattcaatcgaatctaggttaatcaagcctcgacccgat
tgggatttcggttcgggtgatggcgaaagccaggattttgaggagctcgatgtgctgctg
aagctgtgcaatcgagcaggaggaggagagagtgttggcgtcaatggaatggagaaaggg
tttggaattgtggaggacgaaaatgggggtttggtgctgtgtcctctgtgtggggctgac
atttcggatttgagcaacgaagagaggcaggtccatagcaatgagtgtcttgacgaagag
gaagttcaagctcaagacgctccgtgtcctgatgaggaaagggggcatcaaaattctggg
cacgttcttgagtggctgcgcagcctgggattagagaagtacaaggatgtttttgttcga
gaagagattgattgggacactctacaatggctcacagaagaggatttgtttagcataggc
attactgcacttggtccgcggaagaagattgtgcatgcccttgctcaacttagagaaggt
gccactactactactagtagttcaactgaagcacaaccaagaaaaaggagagccaatgga
gtcgatatgcccaatgatgcttcagaagcacccgttaatgatgttagtaaaacagctgca
aacaaattgatcacagattacttcccgggatttggaactgctaggaagcaagtttgcacc
acctctagagaacagcgaagggtagaaaagcgggtgccacgttctggtcagaaacgtggt
gtggaaaacaataatgccacaaatcggaaactcagggatattccctcgtggtgttgcata
ccaggaacaccatttcgagtggacgctttcaaatatcttagacgggattgttcgcattgg
tttctaactcactttcatatggatcattatcaaggtctaacgaagtccttctgtcacgga
aagatttattgctcctccatcacagctaagcttgtaaatatgaagattggcattccatgg
gacagtatacaggttgtacccgtcaaccataagatgaatatttctggtattaatgtgacc
tgcttggatgcaaaccactgtcctggttcgataattatactttttgaaccacccgacggt
aaggctgttctgcatacaggggactttcgctatagcaacagcgcggcaagcatgtctttt
ttgcaaacatgttctatccatactctcatccttgataccacttattgtaatccacagtat
gattttccaaagcaggaggctgtaatacagttcgtcattgatgccattcaagctgaaact
ttcaaccctaaaactctatttctgatcggcagctacactattggaaaggaacgacttttt
ttggaggttgctcgtgtgctccggaaaaagatttatgttaatgcaggaaagctgcatact
ttaaaatgcttggattttcctgaagaagatatgcagtggtttacattaaacgaacaggaa
agccatatccatgtggtccctatgtggacacttgcaagcttcaagcgactgaagcatatt
tccaatcaatactcgagtcgattcagccttatcgttgctttctctccaactggttggact
tttggtaaaggaaagaagaagtccccgggaagaagatcacagcagggtaccgttataagg
tatgaggtgccatacagcgagcattccagctttacagaactcagagagtttgtgaagctt
gtttctccagtggaaataatacctagtgtgaataatcacggaccagattctgccaaggcc
atggtttctctgttgtcatcttaa

DBGET integrated database retrieval system