KEGG   Pyrus x bretschneideri (Chinese white pear): 103954018Help
Entry
103954018         CDS       T03446                                 

Definition
(RefSeq) ent-kaurene oxidase, chloroplastic-like
  KO
K04122  ent-kaurene oxidase [EC:1.14.14.86]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00904  Diterpenoid biosynthesis
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    103954018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pxb00199]
    103954018
Enzymes [BR:pxb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     103954018
Cytochrome P450 [BR:pxb00199]
 Cytochrome P450, plant type
  CYP701 family
   103954018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 DUF922
Motif
Other DBs
NCBI-GeneID: 103954018
NCBI-ProteinID: XP_009364103
LinkDB All DBs
Position
Unknown
AA seq 514 aa AA seqDB search
MAPMSQILQDFQAMPFAVPAAIAALSLFFLFSFKSFVFTKKNAFSKLPSVPVVPGMPLVG
NLLQLKEKKPYKTFTRWAEEYGPIYSIKTGASTMVVLNSTDVAKEAMVTRYPSMSTKKLS
NALKILTFDKCMVAISDYNDFHKMIKRYILTNVLGANAQKRHRSHRDTMRDNVASRLHAH
VKKSPQEAINFRKIFESELFGISLKQAIGKNIEDGIYVEELGTTLSRDDIFKVLVLDIME
GAIEVDWRDFFPYLRWVPNKTIENKIQRLYHRRKAVMNALIEEQKKRIASGEELNCYIDY
LLSEAKTLTPEQIAMLLWETIIETADTTLVTTEWAMYELAKDQKRQDRLFEEIQNVCGTN
KITEEHLSQMPYLGAVFHETLRKHSPAPIVPLRYVHEDTQLGGYYVSAGTEIAINIYGCN
MDKNQWESPEEWKPERFLEPKYDPMDLYKTMAFGAGKRVCAGSFQAMLIACTTIGRLVQE
FEWKLRDGEEENVDTVGLTTHKLHPMHAILKPRN
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcccccatgagccagattctccaagatttccaagcaatgccctttgcagtccctgct
gccattgctgctctgtctctgttcttcctgttttccttcaaatctttcgtctttaccaag
aagaatgctttttccaaactcccttctgttccagttgtgccagggatgcctctggtgggg
aacttgctgcagctgaaggagaagaagccgtacaagacgtttactaggtgggccgaggag
tacgggccaatatattccatcaagactggtgcttccaccatggttgttctcaattcaact
gatgtcgccaaagaggccatggtgaccagatatccgtccatgtcaacgaaaaagctatca
aatgcactaaagattctcactttcgataaatgtatggttgcaataagtgactacaatgat
tttcacaagatgataaaacgatacatactcacaaatgttcttggagcgaatgcccagaag
cgacaccgaagccacagagataccatgagggataatgttgcaagccgattgcatgctcat
gtaaagaaatctcctcaagaagctataaatttcagaaagatattcgagtctgaactcttt
ggaatttctctgaagcaagctataggtaagaacatagaagacggcatttatgtggaggag
cttggtactacattatcaagagacgacatctttaaggttcttgtgcttgacataatggag
ggtgcaatcgaggttgattggagagacttcttcccttacctgagatgggttcctaataag
accatagaaaataaaattcagagactctatcaccgcaggaaagcagtaatgaatgccctg
attgaggagcagaagaagcgaattgcttcaggagaggaattgaattgttatattgactac
ttgctttctgaagcaaaaacgctaacaccagagcaaatagccatgttgctttgggagaca
attatcgagacagcggatactacattggtaacaacagagtgggctatgtatgaacttgca
aaagatcagaaacgacaggatcgtctctttgaagaaatccaaaatgtttgtggaaccaac
aagattactgaggaacacttgtcccagatgccgtatctgggtgctgttttccatgagact
ttaaggaagcacagtccagctcctatagttcctctaagatatgtgcacgaagatacccaa
ttaggcggttactatgtttcagccggaacagagatcgcgattaacatatacgggtgcaac
atggacaagaaccaatgggaaagccccgaagaatggaagccagagagatttttggaaccg
aaatacgatccaatggatttgtacaaaacaatggcgtttggagccggaaagagggtgtgt
gccggttcttttcaggcgatgctgatagcgtgcaccaccatcggaaggctggtacaggag
tttgagtggaagctgagagatggagaagaggaaaatgtggacaccgtcgggctcaccact
cacaaactgcatccaatgcatgcaatcctcaaaccaagaaattag

DBGET integrated database retrieval system