KEGG   Pyrus x bretschneideri (Chinese white pear): 103954605
Entry
103954605         CDS       T03446                                 

Definition
(RefSeq) beta-glucosidase 12-like
  KO
K13032  prunasin beta-glucosidase [EC:3.2.1.118]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00460  Cyanoamino acid metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    103954605
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.118  prunasin beta-glucosidase
     103954605
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 103954605
NCBI-ProteinID: XP_009364717
LinkDB
Position
Unknown
AA seq 560 aa
MQYAGKRQTYPTSPNTFQLLMAMKLGSLFLFVVLLTDFALTNSKAANTDPPIVCDSLNRS
SFDSLVPGFIFGTSSAAYQVEGAWNESGRGPSVWDNFTHQYPEKISDHSNGDVAIDQYHL
YQDDVKIMKNMSMDAYRFSISWSRLLPSGTLSGGINKEGIEYYNNLTNELLSNGIKPFVT
LFHWDVPQALVDEYGGFLSARIVNDFQDFADLCFDQFGDRVKHWITLNEPRTVSNHGYAI
GIHAPGRCSAWYNPNCTGGDSSTEPYIVTHNQLLAHATAVKLYKDKYQACQNGTIGITVV
SYWFEPASETQWDRDAALRALDFMFGWFMDPLTHGDYPQTMRAIVGERLPSFTKEQSELL
SGSYDFIGLNYYSARYASVASYNCSDNPSYVTDPRVNVTTELDGVPIGPQAASDWLYVYP
KGIQDFLLYTKEKYNDPLIYITENGVDEFNDPTLPLPEALNDTNRIDYYNRHLCYVQAAI
KNGTNVKGYFAWSVLDNFEWSDGYTVRFGIIYVDYESLQRSSKSSTYWFQSFLKKSSNNT
EEIKSFVDGGVGNTEFVYQI
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcaatatgcagggaagcggcaaacctaccctacatcaccaaataccttccagttactt
atggctatgaaattgggctctttgttcttatttgttgtgctactcactgactttgcactg
acaaatagcaaagctgctaacacagatccacccattgtctgtgactctcttaacagaagc
agttttgattctcttgtaccagggttcatatttggcacatcttcagcagcttatcaggta
gaaggtgcttggaatgaaagtggtagaggaccgagcgtgtgggataacttcacccaccaa
tatccagaaaaaatcagtgatcacagcaatggagatgttgctattgatcagtatcacctt
tatcaggacgatgtgaaaattatgaagaacatgtcgatggatgcttataggttctcaatc
tcatggtcaagattgttaccaagtggaacgctaagtgggggcattaacaaggaaggcatc
gagtactacaacaatctcactaatgaactcctaagcaatggtataaagccatttgtgacg
ctctttcattgggacgttccccaagctttagtagacgaatatggtgggtttttaagtgct
cgaattgtcaatgattttcaagactttgcagacctttgttttgatcagtttggagatcga
gtaaaacattggatcacgttgaatgaaccacgtaccgtgagtaatcatggttatgcaatc
ggaatccatgcaccaggacgatgctctgcttggtataacccaaactgcaccggtggagat
tcaagtactgaaccatacattgtgacacataaccaactccttgctcatgcgaccgctgta
aagttgtacaaggataaataccaggcatgtcaaaatggaacaataggaataacagtggtg
tcatactggtttgagccagcttcagagacacagtgggatagagatgctgcacttcgagct
ttagactttatgtttggatggttcatggacccactaacacatggtgactatcctcaaacc
atgcgagctattgttggagagcgattaccaagttttacgaaagaacaatccgagttgcta
agtggctcatatgattttattggactaaattactattctgctagatatgcaagcgttgca
tcttacaattgttctgataatccaagctatgtaacagatcctcgcgttaatgttacaact
gagcttgatggagtccccatcggtccacaggctgcttctgactggttatatgtttatcca
aaaggaattcaagactttttactctacacaaaagaaaagtataatgacccattgatttac
attacagagaatggggttgatgagttcaatgatcctacattaccgctacccgaagccctt
aatgataccaatagaattgactactacaatcgccacctatgttacgttcaagcagcaatc
aaaaatggcactaatgtgaagggatactttgcatggtcagtgctagataattttgaatgg
agtgatggatacactgttcgatttggtatcatttatgtagattacgaaagtctacaaaga
tcctcaaaatcctcaacgtactggttccaaagtttcctcaagaagtcctcaaacaatacg
gaagaaatcaaatcatttgtggatggtggtgttgggaacaccgaatttgtgtatcaaatt
tga

DBGET integrated database retrieval system