KEGG   Pyrus x bretschneideri (Chinese white pear): 103956959Help
Entry
103956959         CDS       T03446                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF-like isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103956959
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pxb03036]
    103956959
Enzymes [BR:pxb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103956959
Chromosome and associated proteins [BR:pxb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103956959
   Polycomb group proteins
    PRC2-EZH2 complex
     103956959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR BAR
Motif
Other DBs
NCBI-GeneID: 103956959
NCBI-ProteinID: XP_009367294
LinkDB All DBs
Position
Unknown
AA seq 916 aa AA seqDB search
MASKASPSASANRSELHEDPPMTRLQENMDVTRKEISLLIENLKKQVVFNRATSIKKRME
VNKQKLAGVTNDMYKLSTERGSSRLTDASRSVDLLTKRQKDAFALQNGIELSNGSNDSSQ
EDGHGSTAVLLESNVAVKSSVRPIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIY
YDQNGGEALICSDSEEEAVDEEEEKRVFVESEDFILRSAIKEVGFSDPMLESLAQYFSRS
PSEVKARYDTLLKEKEASGGCKNRDTEDISQIGNSFLDKDLDAALDSFDNLFCRRCLVFD
CRLHGCSQDLVFPIEKQPLWRPPDDEKVSCGPNCYRSVLKSERIARVSNGDPEEKNATSM
DGASAQISTRKKSSRKKSKSGQSESASSNAKNISESSDSENGSRQGSDKNHPSPKKTKLA
GKSGIRKRNSKRVAERVLVCMQKRQKKMMVSDSDSIVNVGLCSSDMKFRSNSSKDNEDTS
SSSQKNLKSSTSGGFRRKESPAKGSNTVVQGESLDGALDEMIADPPATSSDDNLRREECV
DENIYKQELSDDKTWKTIEKGLFEKGREIFGSNSCLIARNLLNGMKTCWEVFQYMNYSES
KMSCQAGDAANSLVEGYSKGNNEARRRSKFLRRRGRVRRLKYTWKSAAYHSIRKRITERK
DQPCRQYNPCTCQTACGKQCSCLQNGTCCEKYCGCPKTCKNRFRGCHCAKSQCRSRQCPC
FAADRECDPDVCRNCWVSCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLLGRSDISGWG
AFLKNSVPKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLK
FANHSPDPNCYAKVIMVAGDHRVGIFAKERIAAGEELFYDYRYEPDRAPAWARKPEASGS
KKDDGAPSSGRAKKLA
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaaggcttcgccttcagcttccgccaatagatcggagcttcacgaggaccct
ccgatgacgagattgcaagaaaacatggatgtaacccggaaggagatttcattgctcata
gaaaatctaaagaagcaagttgtttttaaccgggctacttctataaagaaaagaatggag
gtaaacaagcagaagttggctggtgtcaccaacgacatgtataaattgtcaacggaaaga
ggaagtagtaggttaactgatgctagtagaagtgtagatctattgacaaagaggcaaaaa
gatgcatttgccttgcaaaatggaattgaattgagcaatgggagcaacgatagctctcaa
gaagatggtcatgggtccacggcagttctactagaatctaatgtagcagtcaagagttct
gttcgtcctatcaagcttccggaagttaaaagactacccccttataccacatggatattt
ttggacagaaaccaaagaatgacagaagatcagtcagtggtaggtcgaagaagaatttat
tatgatcaaaatggaggtgaagcgcttatatgtagtgatagtgaggaggaagcagttgat
gaagaagaggaaaaaagggtttttgttgaatctgaagactttatacttcgctcggctata
aaagaagttggcttctctgatccaatgctggagtcattagcacaatatttctctagaagt
ccatctgaagtcaaggcaagatatgatactctcttaaaggaaaaggaggcttcggggggt
tgtaagaatagggatactgaagacatttcacaaattgggaattcttttcttgataaagat
ctggatgcagctcttgattcatttgacaacctattttgtcgtcgctgcctagtatttgat
tgcagattacatggatgttcacaggatcttgtctttcctattgagaaacaacctctgtgg
agacccccagatgacgaaaaagtatcatgcggtccgaattgctatagatcagtactgaag
tctgaaagaattgctagagtgagcaacggtgatcctgaagaaaaaaatgccacgtcaatg
gatggtgctagtgctcaaatatcaaccagaaagaaatcttctagaaagaagtcaaagtct
ggacaaagtgaaagtgcttcatcaaatgcaaaaaacatctcggaaagcagtgattcagag
aatggatccaggcagggtagtgataaaaatcatccatcgcccaaaaagactaagctagct
ggaaaaagtggaattcgtaagaggaacagcaagagagttgcagaacgtgttttagtttgc
atgcagaagaggcagaagaaaatgatggtttctgattccgattccattgttaatgttggt
ctttgttcaagtgatatgaagtttagatctaattcatccaaagataatgaagacactagt
tcttcttcacaaaagaatctgaaatcttctaccagtggaggatttaggaggaaggaatca
cctgccaagggcagtaatacagttgttcagggtgaatctcttgatggtgcattggatgag
atgatcgctgatccacctgccacaagtagtgatgacaatttgaggagagaagaatgtgtt
gatgaaaacatatataaacaagaattaagtgatgataaaacatggaaaaccattgagaag
ggcctttttgagaaaggcagagagatatttggcagcaacagctgcttaatagcaaggaac
cttttaaatggtatgaaaacgtgttgggaagtgtttcagtatatgaattactcagagagt
aagatgtcctgccaagcaggtgatgctgcaaactcccttgttgaagggtattccaagggt
aataatgaagctagaagaagatcaaaatttttacgtagaaggggtagagttcgtcgtttg
aagtatacttggaaatctgctgcttaccattcaatcaggaaacgaattaccgagagaaaa
gatcagccttgcaggcagtataatccatgtacttgccaaacagcttgtggaaagcagtgt
tcttgtctacaaaatgggacttgttgcgagaagtactgcgggtgtccaaagacttgcaag
aatagatttagaggctgtcattgtgctaaaagtcaatgccgaagccgtcaatgtccttgt
tttgctgcagacagggaatgcgatccggatgtttgtaggaattgctgggtcagttgcggt
gacggtacccttggggttccaagccaaagaggtgacaattatgagtgtagaaatatgaag
cttcttctgaaacaacagcaaagggtcttacttggaagatctgacatatctggctggggt
gcgttcttgaagaatagtgtccccaaacacgaataccttggtgagtatactggggagttg
atctcacatcgcgaagcagataagcgtggaaaaatatatgaccgtgaaaattcatcattt
ctcttcaatctgaacgatcagtttgtccttgatgcttatcgaaagggtgataaattgaag
tttgccaaccattctccagatccaaattgctatgcgaaggtcattatggttgcgggagat
cacagggtgggcatatttgccaaggaacgaattgctgcaggagaggaacttttctatgat
taccgttatgagcctgacagagctcctgcttgggcgcggaagcctgaggcatccgggtca
aaaaaggacgatggagctccttcaagtggtcgtgcgaagaagcttgcttaa

DBGET integrated database retrieval system