KEGG   Pyrus x bretschneideri (Chinese white pear): 103957474Help
Entry
103957474         CDS       T03446                                 

Definition
(RefSeq) aspartate aminotransferase, cytoplasmic isoform X1
  KO
K14454  aspartate aminotransferase, cytoplasmic [EC:2.6.1.1]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00220  Arginine biosynthesis
pxb00250  Alanine, aspartate and glutamate metabolism
pxb00270  Cysteine and methionine metabolism
pxb00330  Arginine and proline metabolism
pxb00350  Tyrosine metabolism
pxb00360  Phenylalanine metabolism
pxb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pxb00710  Carbon fixation in photosynthetic organisms
pxb00950  Isoquinoline alkaloid biosynthesis
pxb00960  Tropane, piperidine and pyridine alkaloid biosynthesis
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
pxb01200  Carbon metabolism
pxb01210  2-Oxocarboxylic acid metabolism
pxb01230  Biosynthesis of amino acids
Module
pxb_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
pxb_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103957474
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103957474
   00270 Cysteine and methionine metabolism
    103957474
   00220 Arginine biosynthesis
    103957474
   00330 Arginine and proline metabolism
    103957474
   00350 Tyrosine metabolism
    103957474
   00360 Phenylalanine metabolism
    103957474
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    103957474
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    103957474
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    103957474
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pxb01007]
    103957474
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pxb04131]
    103957474
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pxb04147]
    103957474
Enzymes [BR:pxb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     103957474
Amino acid related enzymes [BR:pxb01007]
 Aminotransferase (transaminase)
  Class I
   103957474
Membrane trafficking [BR:pxb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    103957474
Exosome [BR:pxb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103957474
  Exosomal proteins of other body fluids (saliva and urine)
   103957474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 103957474
NCBI-ProteinID: XP_009367910
LinkDB All DBs
Position
Unknown
AA seq 460 aa AA seqDB search
MRPQLTSPHAHSSSVSTSSDRRLSALVRHLAAEDQSSSAMDAHNNSISASPASAHANSVF
AHVVRAPEDPILGVTVAYNKDPSPLKLNLGVGAYRTDEGKPLVLNVVRKAEQLLVNDMSR
VKEYLPIVGLADFNKLSAKLILGADSPAIQENRITTVQCLSGTGSLRVGGEFLARHYHER
TIYIPLPTWGNHTKVFTLAGLTVKSYRYYDPATRGLNFQGLLEDLSSAPAGAIVLLHACA
HNPTGVDPTLEQWEQIRQLVRSRGLLPFFDSAYQGFASGSLDGDAQSVRRFAADGGECLI
AQSYAKNMGLYGERVGALSIVCKNADVASKVESQLKLVIRPMYSNPPIHGASIVATILKD
RDLFSEWTVELKAMADRIISMRHQLFESLRAKGTPGDWSHIIKQIGMFTFTGLNSEQVAF
MTKEYHIYMTSDGRISMAGLSSRTVPHLTEAIHAAVTRAA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccacagttaacatcaccccacgcccacagttcttcagtttctacgagtagtgat
cggaggctaagcgctctggtacgacacctcgctgccgaagatcaatcgtcctccgccatg
gatgctcacaacaactccatctctgcctcgccagcttccgcccacgccaattccgtcttc
gctcacgttgttcgcgctcccgaggatccaatccttggggttactgttgcgtataacaaa
gatccaagccctctgaagttgaatttgggtgttggcgcttatcgaaccgacgagggaaaa
ccacttgttcttaatgtggtgagaaaagcagaacagctgctcgttaatgacatgtctcgc
gttaaggaataccttccaatcgttggactggcagatttcaataagctgagcgctaagctg
attcttggtgctgacagccctgctattcaagagaaccggattactaccgtccaatgtctc
tcgggaactggctcattgagagttggaggtgaatttttggcaaggcattatcatgaacgc
acaatatacatacccctgccgacatggggaaaccacaccaaagttttcactctggcaggg
ttgactgtgaaaagttaccggtattatgatccagcaactcgtggcctcaacttccaaggc
ctcttggaagacctcagctctgccccagccggagcaattgtacttctccatgcatgtgct
cataaccccactggtgttgatccaacccttgagcagtgggagcagatcagacagcttgtg
agatcaagaggattattaccgttcttcgacagtgcttatcagggttttgctagcggaagt
ttggatggcgatgcacagtctgttcgtaggtttgctgctgatggtggagagtgccttatt
gctcaaagttatgcaaaaaacatgggtctgtacggcgaacgtgttggagccttaagcatt
gtctgcaagaatgctgatgttgcaagcaaggttgagagccaactgaagcttgtgatcagg
cccatgtactcgaacccacccattcacggtgcatccattgtagccaccattctcaaggat
agggacttgtttagcgaatggacagttgagctgaaggccatggctgatcgtatcatcagc
atgcggcatcagctttttgaatccttgcgtgctaagggcacaccaggtgactggagccac
atcatcaagcaaatcggaatgtttaccttcaccggattgaactccgagcaagttgccttc
atgactaaagagtaccatatttacatgacatccgacgggaggattagcatggcgggtctg
agctcaaggaccgtccctcatcttaccgaggcaatacatgccgctgttactcgcgctgca
tag

DBGET integrated database retrieval system