KEGG   Pyrus x bretschneideri (Chinese white pear): 103957968Help
Entry
103957968         CDS       T03446                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 8 isoform X1
  KO
K21343  ubiquitin carboxyl-terminal hydrolase 15 [EC:3.4.19.12]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pxb01002]
    103957968
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pxb04131]
    103957968
   04121 Ubiquitin system [BR:pxb04121]
    103957968
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     103957968
Peptidases and inhibitors [BR:pxb01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   103957968
Membrane trafficking [BR:pxb04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103957968
Ubiquitin system [BR:pxb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    103957968
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 USP7_C2 DUSP
Motif
Other DBs
NCBI-GeneID: 103957968
NCBI-ProteinID: XP_009368467
LinkDB All DBs
Position
Unknown
AA seq 879 aa AA seqDB search
MEGVALSEDLSDSTQRSDSDSDQRVYFVPYSWWRDAQESVLGDSDGKRAILYVALQASSY
AGPMKLINNIFNSDLVFNLRREDDSVHSGENGEGSVSGRDYALVLGEMWVQALRWHSDSK
VAVKDGRSFSAAEDDMTDVYPLQLRLSVSRETNSLGVKVTKKDNAVEFFKRACKIFSVES
EMLRIWDFSGQINLFFANERAKSSREFQRQSGEIMLELQVYGLSDSFKCREGKKDEMATQ
HSTITNSCCGASVMMNGSAGITNSNFIRSLWGSSCETGSLGLTGLQNLGNTCFMNSSIQC
LAHTPKLVDYFLGDYGREINPDNPLGMNGEIALAFGDLLRKLWVPGATPVAPRPFKSKLS
RFAAQFNGFNQHDSQELLAFLLDGLHEDLNRVKCKPYVEVKDGDGRQDEEVADEYWGNHL
ARNDSIIVDVCQGQYKSTLVCPVCKKVSVTFDPFMYLSLPLPSTMMRTMTLSVVNTYGYS
QPSQYTITVPKHGKLEDLIQGLSVASSLGIDETFLVAEIYNNRIIRYLEEPTDSLSLIRD
QDKLVAYRSTKDVEQIPLVVFMHQLMEEKYMDGKLTSSFGIPLVSRLPNSATGSDICNLY
LKLLKPFHTPSKDSQECFDGSEGTTLEEVTGTQDSTPPVIDGGVNPCNGSEADSPFDFEF
QFYITDEKGISKDRKIVMNDIVEREKTKRLNVLVCWPKKYIEQYDTRLLCSLPEVFKTCL
FAKKPQESVSLYKCLEAFLKEEPLGPEDMWYCPGCKKHCQASKKLDLWRLPEILVIHLKR
FSYSRFFKNKLETYVDFPIDNLDLSTYIAHKSGQSCNRYMLYAVSNHFGSMGGGHYTAFV
HHGGDRWYDFDDSHVNPISQDKIKSSSAYVLFYRRVVEV
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgttgctctctctgaagatctctccgattccactcagcgttccgactcggac
agcgaccagcgagtctacttcgttccctacagttggtggagagatgcacaggaatcagtt
ttgggcgattctgatgggaagagagcgattttgtacgtggctttgcaggcttcttcgtat
gctggccctatgaagctcatcaataacattttcaactcagatcttgtgttcaatctaagg
agagaggatgatagtgtacatagtggtgaaaatggcgaaggcagtgtctcaggccgagac
tacgcattggtgctcggagaaatgtgggttcaggcactcagatggcatagtgattctaaa
gttgcagtgaaggatggtaggagtttttcagctgcggaagatgacatgaccgatgtctat
ccgctacaactcagactttctgtttcacgagaaacaaattcattgggagtaaaagttaca
aagaaggataatgcagttgagttcttcaagagagcctgcaaaattttcagtgtggagtct
gagatgttacgcatctgggacttttcggggcagataaacttattttttgcaaatgaaaga
gccaagtcttcaagagaatttcaacgacagtcaggtgagataatgttggagttgcaagtt
tatgggttgtcagattcctttaagtgcagggaagggaaaaaagatgagatggccacacaa
cattcaaccatcacaaattcctgttgtggtgcttcagttatgatgaatggttctgcagga
atcacaaattctaacttcatccgttcattatggggaagctcttgtgaaacaggttcttta
ggattgacaggattacagaaccttggaaatacttgtttcatgaatagttccatccagtgt
ttagcgcacaccccaaagcttgtggactattttcttggagattatggtagagaaataaat
ccagacaatccattgggcatgaatggggagattgctttagcctttggagatctgttaagg
aagttatgggttcctggagcaactccagtagccccaaggccatttaagtcaaaactttct
cgatttgctgcacagtttaatggatttaatcaacatgattcccaagagctcctggctttt
ttgttggatggacttcatgaagatcttaatcgtgtaaaatgcaagccttatgtagaagtc
aaggatggtgatggccgacaagatgaagaggttgctgatgaatattggggaaatcattta
gcccgtaatgactctataattgttgacgtgtgccaaggtcaatataaatcaacattagtt
tgccctgtttgcaaaaaggtgtctgttacatttgatccatttatgtacctgtcgctacca
ttgccttcaacgatgatgcggacaatgactttatcagtggtcaatacttatggatattct
cagccgtctcaatataccattaccgtgcccaagcatggaaaattagaagatctcatccag
ggtttaagtgttgcatcctcattggggattgatgaaacctttttggtggctgagatatac
aacaatcgcattatacgctatcttgaggaaccaactgattcattatctttaattagggat
caagacaagctagttgcttatcggtcaacgaaagatgttgagcaaatccctttggttgtg
ttcatgcatcagctgatggaggagaagtacatggatgggaaactgacttcaagctttgga
attcctcttgtgtcaagactacccaattctgctactggatctgatatctgcaacttatac
ttgaaattacttaagccatttcacacaccctcaaaagattcccaagaatgttttgatggt
tcagagggcaccactcttgaagaagtcactggaacacaggattccacacctcctgttata
gacgggggtgtgaacccctgtaatggaagtgaggctgactcaccctttgattttgaattt
cagttttacataacagatgaaaagggaatttccaaggatagaaagatagtaatgaatgat
atagtagagagggaaaaaaccaagcggttaaatgtccttgtatgttggccaaaaaagtac
atcgaacagtatgatactcgccttctttgctcattaccagaggttttcaagacttgcctt
tttgcaaaaaagcctcaagagtccgtttctctgtataagtgccttgaagcattcttgaag
gaagagcctcttggacccgaagacatgtggtattgtcctggctgcaaaaagcactgtcaa
gccagcaaaaagttagatctatggagactgccggagatcttggtcattcatttaaagcgg
ttctcatatagccgtttttttaagaacaagctggagacttatgtcgatttccctattgac
aatcttgatttgtcaacatacattgcccacaagagtggtcagtcatgtaatcgttacatg
ctgtatgcagttagtaatcactttggaagcatgggaggtggtcattatactgcatttgtc
caccatggaggtgatcggtggtatgactttgatgatagccacgttaaccctatcagccag
gacaagataaagtcttcatctgcttatgttcttttctacagaagagttgtggaagtgtga

DBGET integrated database retrieval system