KEGG   Pyrus x bretschneideri (Chinese white pear): 103958799Help
Entry
103958799         CDS       T03446                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK1/AtPK6-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pxb01001]
    103958799
Enzymes [BR:pxb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103958799
Protein kinases [BR:pxb01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   103958799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Pkinase_C RIO1 Kdo APH Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 103958799
NCBI-ProteinID: XP_009369397
LinkDB All DBs
Position
Unknown
AA seq 469 aa AA seqDB search
MVTSSRKKTLHSLLAAKLSSLTIPPSSSPSSSSPPQDFDFNEIFGPTATTPNDSSTSAAA
SFPPPPLVIHNRSHSFVGPSPRFTPTPSSLPFTSDFLDSQSDEDESETPIGTENRNGGES
EKTELGARKFGPADFEMLRVVGQGAFGKVFQVRKKSDGDSNGGGDGGDGLFAMKVMRKDT
IIKKNHVDYMKAERDILTKVVHPFIVQLRYSFQTNSKLYLIMDFINGGHLFFHLYRQGIF
SEDQARFYTAEIVSAVAHLHKCGIVHRDLKPENVLVDSDGHVMLTDFGLAKEIDEASRSN
SMCGTTEYMAPEILLSKGHNKDADWWSIGILLYEMLKGQPPFTHANRKKLQERIIKEKVK
LPSYLTSEAHSLLKGLLQKDPSQRLGNGPNGGDNIKSHKWFRSINWKKLEAREVLPKFKP
DVSGKDCTANFDRCWTTMPLEDSPAPTPTAGEHFQGYTYVAPNPWLSSV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgtcatctcggaagaaaacgctccactccctgctggccgcgaagctcagcagc
ctcacaatcccgccgtcctcctccccctcctcctcatccccacctcaagacttcgacttt
aacgaaatcttcggccccacagccaccacccccaacgactcatcaacctccgccgccgcc
tcattcccgcctccgcctctagtcatccacaaccgctctcactccttcgtgggcccctcc
ccgcgcttcactcccactccctcctcccttcccttcacctccgacttcctcgattcccag
agcgatgaagacgaatcggaaaccccaatcggaactgagaatcggaatggtggggaatca
gagaagaccgagctaggagctcggaagttcgggcctgcggattttgagatgctgagagtt
gtgggtcagggcgcgtttgggaaggtctttcaagtgagaaagaagagcgacggcgacagt
aacggcggcggtgacggcggtgatgggctttttgccatgaaggttatgaggaaggacaca
atcataaagaagaaccatgttgattacatgaaagctgagagagatattctcactaaggtt
gtgcaccctttcattgttcagctccgctactctttccagaccaattctaagctttatttg
atcatggattttataaacggggggcatctcttctttcatctataccggcagggaatcttc
agcgaggatcaggcgagattttatactgctgagatagtgtctgctgttgcacatcttcac
aagtgcgggattgtccatcgggaccttaaacctgagaacgttcttgtggattctgatggg
cacgtcatgctaactgattttgggctagcaaaggaaattgacgaagccagcagatcgaat
tcaatgtgtggcaccacagagtacatggctccggaaattttgctgtctaaaggccataac
aaagatgcggattggtggagcatcggtatccttttgtatgagatgctaaaagggcagcca
ccatttacacacgcaaacagaaagaaacttcaggagagaatcatcaaagagaaagttaaa
ctcccgtcgtatctaaccagcgaagctcattctctgctgaaaggattgctacaaaaggat
ccgtcacagaggttaggtaacgggccgaacggaggggataacatcaaaagccataagtgg
tttcgatcaatcaactggaagaagttggaggccagagaagtgctcccaaagttcaaaccg
gatgtgagcggaaaagactgcacggccaacttcgaccggtgctggactacaatgcctctg
gaagactcacccgctcctacaccaactgcgggtgagcatttccaggggtacacttacgtg
gcacctaacccgtggctttcgtcggtataa

DBGET integrated database retrieval system