KEGG   Pyrus x bretschneideri (Chinese white pear): 103960087Help
Entry
103960087         CDS       T03446                                 

Definition
(RefSeq) transmembrane emp24 domain-containing protein p24beta3-like
  KO
K20347  p24 family protein beta-1
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pxb04131]
    103960087
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pxb02000]
    103960087
Membrane trafficking [BR:pxb04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    103960087
Transporters [BR:pxb02000]
 Other transporters
  Others
   103960087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EMP24_GP25L
Motif
Other DBs
NCBI-GeneID: 103960087
NCBI-ProteinID: XP_009370753
LinkDB All DBs
Position
Unknown
AA seq 218 aa AA seqDB search
MEKQKRFETAKICVAYSVLMSFIGNGNVATALSITVMELECVLEQVLYEGDTVSGNFVAI
DHDIFWSSDHPGIDFTATAPGGTTVFSLKGTSGDKFAFKAPKSGLYKFCFRNPVSTPETV
SFYIHVGHIPNEHGLAKDEHMDPLNIKIAELREALEAVTTEQKYLKARDARHRYTNVSTN
KRVIYFTLAEYLVFAGASALQVLYIRNLFSKSVAYNRV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggagaaacaaaagcgatttgagaccgccaagatttgcgtggcgtacagtgttcttatg
agcttcatcggcaatggcaatgttgctactgctctttcaatcaccgtgatggagttggaa
tgcgtcttggagcaagttctgtacgagggagacacggtctccggaaactttgttgcaatc
gaccacgacatcttctggagctccgaccaccctggtatcgatttcactgccacagctcca
ggaggcactactgtgttttcgttgaaaggaacgtccggggataagttcgcattcaaggca
ccgaaaagcggattgtacaagttttgttttcgcaatcctgtttcaactcctgagactgtt
tcgttctacattcatgttggccacatcccaaatgagcatggcttagccaaagacgaacat
atggaccctttgaatattaagattgctgagctgagagaagcactggaagctgtcacaaca
gagcaaaagtaccttaaagcacgcgatgctaggcatcgatatacaaatgttagcaccaat
aaacgagtgatctacttcacacttgcagagtaccttgtgtttgctggtgcaagtgctctt
caagtgttgtacatccgcaacctgtttagcaagtctgttgcctataacagagtttga

DBGET integrated database retrieval system