KEGG   Pyrus x bretschneideri (Chinese white pear): 103962170Help
Entry
103962170         CDS       T03446                                 

Definition
(RefSeq) alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial-like
  KO
K00827  alanine-glyoxylate transaminase / (R)-3-amino-2-methylpropionate-pyruvate transaminase [EC:2.6.1.44 2.6.1.40]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00250  Alanine, aspartate and glutamate metabolism
pxb00260  Glycine, serine and threonine metabolism
pxb00270  Cysteine and methionine metabolism
pxb00280  Valine, leucine and isoleucine degradation
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103962170
   00260 Glycine, serine and threonine metabolism
    103962170
   00270 Cysteine and methionine metabolism
    103962170
   00280 Valine, leucine and isoleucine degradation
    103962170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pxb01007]
    103962170
Enzymes [BR:pxb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.40  (R)-3-amino-2-methylpropionate---pyruvate transaminase
     103962170
    2.6.1.44  alanine---glyoxylate transaminase
     103962170
Amino acid related enzymes [BR:pxb01007]
 Aminotransferase (transaminase)
  Class III
   103962170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 103962170
NCBI-ProteinID: XP_009373123
LinkDB All DBs
Position
Unknown
AA seq 481 aa AA seqDB search
MHGLIGRRVFSGSAKSLRWQQQRFFSKVAQREEALPQDNGVDGLKMPPCDYTPPPYTGPT
ADEILAQRKKYLSPSMPYFYDKPLNIVDGKRQYLFDEKGRRYLDGFGGIATVSCGHCHPD
VVEAIVNQTKRIQHSTILYLNHAIGDFAQALANKLPGNLKVVFFTNSGTEANELAMLIAR
LYTGCHDIISLRNAYHGNGAGTMGATAQANWKFNVIQSGVHHAVNPDPYRGVFGSDGEKY
AKDVQDLIDFGTSGHVAGFLCEAIQGVGGIVELAPGYLPAVYNSVKKAGGLFIADEVQSG
FARTGSNFWGFEGHGVVPDIVTMAKGIGNGIPLGAVVTTSEVAEVLTRRNYFNTFGGNPV
CTAAGLAVLNVIEKEKLQENALLVGSYLKERLNALKDKYELIGDVRGRGFMLGVELVTDR
ELKTPAKAETIHVMDKMKDLGVLIGKGGFYGNVFRITPPLCFTKEDADFLVDAMDYTISK
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcatggtttaatagggagaagggtattctcgggaagtgcaaaatccctgcggtggcaa
caacaacgcttcttctctaaggtggctcaaagggaggaagcccttccccaagacaatggc
gtcgatggtctcaaaatgcccccctgcgattacacccctccgccgtacaccggccctacc
gccgacgagatccttgcccagcgcaagaagtatcttagcccctccatgccctacttctac
gacaaacccctgaacattgtggacgggaagaggcagtacttgttcgacgagaaggggcgg
aggtatttggacggattcggggggattgcgacggtgagctgcggccactgccatccggac
gtggtggaggccatagtcaaccaaaccaagcgcatacaacactccaccatcctctacctc
aaccacgctatcggcgacttcgctcaggcgctcgctaacaagttgcccggcaatctcaag
gtggtgttttttacaaactcggggacagaggcaaacgagttggcaatgctgattgcgcgg
ttgtacactggatgtcacgatataatctcgctgaggaatgcatatcatggcaacggcgct
ggcaccatgggagccactgcccaagccaactggaaattcaacgtcatacagagtggagtt
catcacgccgtaaatccggatccatacagaggagtttttggttcagatggagagaaatat
gccaaagatgtccaagatctcatagacttcggaacctcaggccatgttgctggtttttta
tgtgaggctatccagggagtaggaggaattgtagaactagctccaggttacttaccagcc
gtttataatagcgtgaagaaagctggaggacttttcattgctgatgaagtccaatcgggt
ttcgctcggacggggagcaacttctggggatttgagggccacggtgttgtgcctgacatt
gtgacaatggcaaagggaattggaaatggcatcccccttggtgctgtggtaaccacttct
gaggttgcagaggtcctaactcgccgcaattacttcaacaccttcgggggtaatccagtg
tgtacagctgcaggactggcagttctaaacgtgattgagaaagaaaaactgcaggagaat
gcgttgctcgtgggatcgtatctgaaggaaagactcaatgctcttaaggataaatatgaa
cttattggcgatgtgaggggaaggggattcatgctcggagttgaacttgttactgatcgt
gagctgaagacacctgcaaaggctgaaaccatacacgtaatggacaagatgaaagatttg
ggagtcttgatcggcaaaggtggcttctacggaaatgttttcagaatcacacctccccta
tgcttcaccaaggaagatgcagattttcttgtggatgcaatggactacacgatctcgaaa
atttga

DBGET integrated database retrieval system