KEGG   Pyrus x bretschneideri (Chinese white pear): 103963429Help
Entry
103963429         CDS       T03446                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP53
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pxb03009]
    103963429
Enzymes [BR:pxb01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     103963429
Ribosome biogenesis [BR:pxb03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    103963429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL
Motif
Other DBs
NCBI-GeneID: 103963429
NCBI-ProteinID: XP_009374526
LinkDB All DBs
Position
Unknown
AA seq 483 aa AA seqDB search
MGFWGIEVKPGKSYEHQSDQFEGRLHISQATLGLGESKGRSIVQCSIGDKSPIFLCSLLP
NKNESVPLDLDFEPIDGLVTFSVIGKRSIHLSGYLVEEGEDEGDDYGSDSSGEDIADTES
ESSEYDTDDDNVGFIDDEDFDMYPPSPVPNSGVVIEEIEDDEKPTNGNSRSKRQVKKNQS
NDSEKITNSQQQIVVKENAGDPVLESEDEDGFPISTKQKTNIEKHEAATEQKDSKITEKT
KKKKVNDGEAAGSKRKVEDVQQDSQPEGEKNNKKKKKKLKEQAKEGNADDNEKQPEILKS
QEHEQKLSNKKRSDIEKNSIPGENLTEGKKKKKKNKKAQETETKIDMDEIVDNMEDQNKP
GLEQTSGKRSKAKTYPNGLVIEELAMGKPDGKKTSSGKKVSVRYIGKLKNGNIFDSNVGG
PPFKFRLGLGQVIPGWDVGVNGMRVGDKRRLTIPPEMGYGHKRAGKIPPNSWLVFDVELL
GVN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggattttggggaattgaagtaaaaccaggaaaatcgtacgagcatcaatcggatcaa
ttcgaaggaaggcttcacatttctcaggcgactttaggcctcggtgaatcgaaggggagg
agtatagttcagtgttccattggagataaaagtccaatctttctatgttctttgttacca
aataagaatgaatctgtccccttggatcttgattttgagccaattgatggtttggtgacc
ttctcggtgattggaaaacgaagtatccacctctctggttaccttgtggaggaaggcgag
gatgaaggagatgactatggatcggattcttccggggaggatattgcggacaccgagtca
gagtcttcagagtatgataccgatgatgataatgttggatttattgacgatgaagatttt
gacatgtacccgccttcacctgttccaaatagtggagttgtaatcgaggagatagaggac
gatgagaaacctactaatggaaacagtcggtccaaacgacaagtgaaaaagaatcaatcg
aatgactctgaaaagatcacaaattctcagcaacaaattgttgtcaaggaaaatgctggt
gaccctgttttggagagtgaagatgaagatggttttccaatatccactaaacagaaaacc
aacattgagaagcatgaagcagcaactgaacagaaggatagcaaaattactgagaaaacc
aagaagaagaaagtgaatgatggtgaagctgctgggtccaaaaggaaagtcgaagatgtt
cagcaagacagtcagccagaaggggaaaagaataataagaagaagaagaagaaattgaaa
gagcaagctaaggagggtaatgctgatgacaatgaaaagcaacctgagattttgaagagc
caagagcatgagcaaaagctatctaataagaagagatctgacatcgaaaagaattctatt
cctggtgaaaatctcacggaggggaaaaaaaagaagaaaaagaacaagaaagcccaggag
actgaaacaaaaattgacatggatgaaatcgttgacaacatggaagatcagaacaaacct
ggtttggagcaaaccagtggcaagcgatccaaagcgaaaacctatccaaatggattggtt
atcgaggagctagctatgggaaaacctgatggcaagaaaacttcttcgggaaaaaaggtc
agtgttcgctacattggcaagctaaagaatggcaacatatttgactccaacgtgggaggg
ccacctttcaaattccgcctaggtctaggacaagttataccaggatgggatgtcggggtt
aatggtatgcgtgttggggataaaagaagactcactattccaccagaaatgggttatgga
cataaacgtgccggtaaaataccaccaaactcatggcttgtgtttgatgttgagctgctc
ggtgttaattga

DBGET integrated database retrieval system