KEGG   Pyrus x bretschneideri (Chinese white pear): 103964651Help
Entry
103964651         CDS       T03446                                 

Definition
(RefSeq) probable hexokinase-like 2 protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00010  Glycolysis / Gluconeogenesis
pxb00051  Fructose and mannose metabolism
pxb00052  Galactose metabolism
pxb00500  Starch and sucrose metabolism
pxb00520  Amino sugar and nucleotide sugar metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
pxb01200  Carbon metabolism
Module
pxb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103964651
   00051 Fructose and mannose metabolism
    103964651
   00052 Galactose metabolism
    103964651
   00500 Starch and sucrose metabolism
    103964651
   00520 Amino sugar and nucleotide sugar metabolism
    103964651
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103964651
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pxb04131]
    103964651
Enzymes [BR:pxb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103964651
Membrane trafficking [BR:pxb04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103964651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 103964651
NCBI-ProteinID: XP_009375879
LinkDB All DBs
Position
Unknown
AA seq 536 aa AA seqDB search
MRKKVVVVASVIVSTTVVAAAVLLRQWKRKKQRQWRETQKILRKFARDCATPVPKLWQVS
NALVSDMKACLASSGTITTLNMLVSYVAPLPTGDEEGFYYGVNLRGTNFLILCARLGGKN
NPISNLNREEIPIPSNLMAATAKELFDFIAVELGKFVSEHPNTSAKEMSKLGCIVSCPVE
QSVVSDGTAIKWKSFSADSKVGKRLVSDFNKALEEHAVKLRVYAMQVDDTVGNLAGGRYY
NRESVAAVTLAMGTDAAYVEPANAALQWHGPSPKLGDMVISTQWGDFSSPHLPITIFDTC
LDAESPNPGCRRFEKLISGMYLGEIVRRVLLKMAQETALFGDTVPSKLMTPYQLSSPDMA
AMHQDTSEDHEIVSEKLKKVFGITSTSPRAREVVSEVCDIVAERGARLAGAGILGIIKKL
GRIENKKSVVTVEGGIYEHYRVFRNYLNSSVWEMLGNDLSDNVVIEHSHGGSGTGALFLA
ASQMEMQNDDPDPEHDPDTDPGNDDDDDDEPDIDDPHPGNDDHDRGNDVRDPNPNT
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagaaggtggtggtggtggcatcagtgatcgtaagtaccacagtggtagcggca
gcagttttactgagacagtggaagcggaagaaacagcgtcaatggagagaaacacaaaaa
atactacgcaaatttgccagggactgcgccactccggtgccaaagctttggcaggtctca
aatgccttggtgtctgacatgaaagcttgccttgcttccagtgggaccatcacaactctc
aacatgctggtttcctatgtcgctcccctccccaccggagatgaggaaggattttattat
ggcgtaaatttgcggggaacgaacttcttgatcttgtgtgccagacttggagggaagaac
aaccccatttcaaatttaaacagggaggagattcccattccctccaatctcatggctgct
actgcaaaggaattatttgattttattgctgtggagctaggaaagtttgtttcagaacat
cccaatacatcagcaaaggagatgagcaaacttggttgtatagtatcatgtccagtcgaa
caatctgttgtctccgatggaaccgctatcaaatggaagagtttctcagctgatagcaaa
gttggaaaaaggttggtgagtgacttcaacaaagctctggaggaacatgcagtgaaattg
cgggtttacgcaatgcaggttgatgataccgtaggaaatttggcaggaggtagatactac
aacagagaaagcgtggctgcggttactctggcaatgggcacggatgctgcttatgtagag
cctgcaaatgcagctctccagtggcatggtccatcgcctaaattaggcgacatggtaatt
agcacacagtggggagatttcagttctcctcatcttccaataaccatctttgatacttgt
ttagatgctgaaagtccaaatcctggatgccggagattcgagaagctgatttcgggaatg
tatctgggagaaattgtgagaagagtattactgaagatggcacaggaaacagcattattt
ggagacacggtgccttcaaaactcatgactccttaccaattgagttcacctgatatggct
gccatgcatcaagatacatcagaggatcacgaaattgtcagcgaaaaactgaagaaagtt
tttgggatcactagtacttctccaagggcaagggaggtagtttcggaggtttgtgacatc
gttgcagaacgtggagcccgtcttgctggagctggtattcttgggataattaagaagctt
gggagaattgaaaacaagaaaagtgtagttaccgtggaaggtgggatttacgagcactat
agggtcttcagaaattatctcaacagcagtgtgtgggaaatgcttgggaatgatctttca
gacaatgttgtcattgaacattctcatggtggttcaggaactggagccctatttcttgct
gcatcccaaatggaaatgcagaatgacgatcctgatcctgaacatgaccctgatactgat
cctggtaatgatgatgatgacgatgatgaacctgacattgatgatccccatcctggtaat
gacgatcatgatcgtggtaatgatgttcgtgatcctaatccgaatacctga

DBGET integrated database retrieval system