KEGG   Pyrus x bretschneideri (Chinese white pear): 103965062Help
Entry
103965062         CDS       T03446                                 

Definition
(RefSeq) 3-ketoacyl-CoA thiolase 2, peroxisomal
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00071  Fatty acid degradation
pxb00280  Valine, leucine and isoleucine degradation
pxb00592  alpha-Linolenic acid metabolism
pxb01040  Biosynthesis of unsaturated fatty acids
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
pxb01212  Fatty acid metabolism
pxb04146  Peroxisome
Module
pxb_M00087  beta-Oxidation
pxb_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103965062
   00592 alpha-Linolenic acid metabolism
    103965062
   01040 Biosynthesis of unsaturated fatty acids
    103965062
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103965062
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103965062
Enzymes [BR:pxb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     103965062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 103965062
NCBI-ProteinID: XP_009376354
LinkDB All DBs
Position
Unknown
AA seq 459 aa AA seqDB search
MEKAINRQRVLLDHLRPPSADSSSSLSASACAAGDSAAYARTNVFGDDVVIVAAYRTPIC
KAKRGGFKDTHADDLLAPVLKAVVEKTNVNPSEIGDIVVGTVLAPGSQRASECRMAAFYA
GFPETVPIRTVNRQCSSGLQAVADVAASIRAGFYDIGIGAGLESMTANPMAWEGSVNPKV
KIFEQAQNCLLPMGITSENVAHRFGVSRKEQDQAAVDSHRKAAAATATGKFKDEIIPVAT
KIVDPKSGEEKPVTISVDDGIRNTTLADLAKLKPVFKKDGSTTAGNSSQVSDGAGAVLLM
KRSVAEQKGLPILGVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAF
ASQYLYCRNKLGLDPEKINVNGGALAIGHPLGATGARTVATLLHEMKRRGKDCRFGVISM
CIGTGMGAAAVFERGDSVDGLCNARKVETHIHLLSKDAR
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagcgatcaacaggcagcgtgttctgctcgaccacctccgccctccctccgcc
gactcttcttcttctctctccgcatcggcatgtgcggctggggacagcgctgcatatgcg
aggacaaacgtgttcggagatgatgtggtgattgttgcagcttatcggactccgatttgc
aaggcgaaacgcggcggcttcaaggatactcatgctgatgatcttcttgcacctgttttg
aaggcagttgtagaaaagaccaatgtgaacccaagtgaaattggagatattgttgtgggt
acagtgttggctccaggatctcaaagagctagtgagtgcaggatggctgccttttatgct
ggcttcccagagactgtgccaattagaaccgtgaacagacaatgttcatctgggcttcag
gccgttgctgatgtagctgcgtctataagggcaggattttacgatattggaattggggct
gggttggaatctatgactgcaaatccaatggcatgggaaggatcagttaaccctaaagtg
aagatatttgaacaagcccagaattgccttcttcctatgggaatcacctcagaaaatgtt
gctcatcgatttggagtttcacgcaaggagcaagatcaggctgcagttgattctcatagg
aaggcagctgctgctactgctaccggtaaatttaaagacgaaattattcccgtggcaacc
aagattgtcgacccaaaatctggtgaggagaaacctgttacaatttctgttgatgatggg
attcggaacacaacattggcagacctggcgaagttgaagcctgtctttaagaaagatggg
agcaccactgctggtaactctagtcaagttagtgatggtgctggagctgttctcttgatg
aagagaagcgttgctgagcaaaaaggattgccaattctgggtgtattcaggagtttttct
gctgttggtgtggatccagccatcatgggtgttggcccagctgttgcaattccagctgca
gtcaaggctgctggtttagagcttgatgatattgatctttttgagataaatgaggccttt
gcatcccaatatctctattgccgtaacaagttgggccttgatccagagaagatcaatgtt
aatggaggtgcacttgccattgggcatccacttggtgcaacaggtgctcgcactgttgcc
actttattgcatgagatgaagcgacgtggaaaggattgccgctttggagtgatatcaatg
tgcataggcacagggatgggggcagcagctgttttcgaaaggggggactctgtcgacgga
ctgtgtaatgcgcgcaaagttgaaacccacattcatcttttgtccaaggatgctaggtag

DBGET integrated database retrieval system