KEGG   Pyrus x bretschneideri (Chinese white pear): 103965603Help
Entry
103965603         CDS       T03446                                 

Definition
(RefSeq) rac-like GTP-binding protein ARAC3
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb04145  Phagosome
pxb04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103965603
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103965603
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pxb04131]
    103965603
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pxb04147]
    103965603
   04031 GTP-binding proteins [BR:pxb04031]
    103965603
Membrane trafficking [BR:pxb04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    103965603
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    103965603
  Macropinocytosis
   Ras GTPases
    103965603
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    103965603
Exosome [BR:pxb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103965603
  Exosomal proteins of other body fluids (saliva and urine)
   103965603
  Exosomal proteins of colorectal cancer cells
   103965603
  Exosomal proteins of bladder cancer cells
   103965603
GTP-binding proteins [BR:pxb04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    103965603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf AAA_7
Motif
Other DBs
NCBI-GeneID: 103965603
NCBI-ProteinID: XP_009376954
LinkDB All DBs
Position
Unknown
AA seq 198 aa AA seqDB search
MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD
TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWVPELRHYAPSVPIILVGTKL
DLRDDRQFFVDHPGAVPITTAQGEELKKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP
PKQKKKKKRKAQKACSIL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctccaggttcataaagtgtgtcacggttggggatggagctgtgggaaaaacc
tgtatgctcatctcctacaccagcaacacttttcctacggattatgtgccaactgtgttt
gacaatttcagtgcaaatgttgttgtggatgggagcaccgtcaatttggggttgtgggac
actgctgggcaggaagattacaatagattaagaccactgagctatcgtggggcagatgtc
ttcctacttgcgttctctctcataagcaaggccagctatgaaaatgttgccaagaaatgg
gttcccgaattgaggcattatgcacctagtgttccaattattcttgttggaactaagctc
gatcttcgggatgataggcagttctttgtagatcaccctggtgcagtgccaattaccaca
gcacagggagaagaactaaagaagctgattggggctccagtttacatagaatgcagttca
aaaacgcagcagaatgtgaaagcagtcttcgatgcagccattaaagtggttctccagcca
ccgaagcagaagaagaaaaagaagagaaaggcacagaaggcctgctccatattgtga

DBGET integrated database retrieval system