KEGG   Pyrus x bretschneideri (Chinese white pear): 103966404Help
Entry
103966404         CDS       T03446                                 

Definition
(RefSeq) heat shock 70 kDa protein 18-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb03040  Spliceosome
pxb04141  Protein processing in endoplasmic reticulum
pxb04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103966404
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103966404
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103966404
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pxb01009]
    103966404
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pxb03041]
    103966404
   03009 Ribosome biogenesis [BR:pxb03009]
    103966404
   03110 Chaperones and folding catalysts [BR:pxb03110]
    103966404
   04131 Membrane trafficking [BR:pxb04131]
    103966404
   03051 Proteasome [BR:pxb03051]
    103966404
   03029 Mitochondrial biogenesis [BR:pxb03029]
    103966404
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pxb04147]
    103966404
Protein phosphatases and associated proteins [BR:pxb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103966404
Spliceosome [BR:pxb03041]
 Complex B
  Other components
   Prp19 complex
    103966404
 Complex C
   Prp19-CDC5 complex
    103966404
Ribosome biogenesis [BR:pxb03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103966404
Chaperones and folding catalysts [BR:pxb03110]
 Heat shock proteins
  HSP70 / DNAK
   103966404
Membrane trafficking [BR:pxb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103966404
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103966404
Proteasome [BR:pxb03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103966404
Mitochondrial biogenesis [BR:pxb03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103966404
Exosome [BR:pxb04147]
 Exosomal proteins
  Proteins found in most exosomes
   103966404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 Retrotran_gag_2 MreB_Mbl FGGY_C Ppx-GppA Retrotran_gag_3
Motif
Other DBs
NCBI-GeneID: 103966404
NCBI-ProteinID: XP_018507709
LinkDB All DBs
Position
Unknown
AA seq 680 aa AA seqDB search
MAGENMGPAVLVPIKLTSDNIYGYQQWKSSSLSYFRYHNLLGIIDGTDTRPDQQLHSAEF
FNWSNRDQKVLEWLRNTLSIDLHHRVMAGADSSQTVWRNIKKHFESLPLAYIYNLKSELV
NVKKDTAMSMNDYLQKIFHLAQLLADAGARVEDGDLFYLHILTGLPKEHRTRLENSNPRS
FQEVKHLLLKQEEEIYLLNEQRRYTNTASNQATKPPPNTVSGSVVVSPNLHQPSLSHDKG
GGEEEHAVGIDLGTTYSCVAVWQKDHVETILNDYGNRKTASYVAFTNTEEAMIGDAAFNQ
VVRNTANSIFDTKRLIGRRFSEDSVQSDMKLWPFKVTQGSDDRPMIVVTRNGGEEKQITP
EEIASMILKKMRKIAETHLGSPVKNAVITVPAYFNDSQRQAIKEAGVVAGLDVKCVIDEP
SAAALAYGLHKKTGWSSSRNVMIFDLGGGSLGVSLVTMNTSGTFQVMATGGDGHLGGEDF
DNRMVNYCVEEFKTKSKLDVSKDFRALRRLKNQCEKAKRRLAFESDFDIEIDHLCEDKDF
NITFTRDMFEQINMDLFIKCMESVEKCLRDANMDPSNVDDVLLAGGSSRIPMVQQLLQQA
FKGKELCKGIDLDEAMAHGAAVQAAISCGNGKGKLQDYITLSDVTPSPGATPLADATDKT
ARGRPHSWTNTISSIFGSSK
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggccggagagaacatgggaccagcagtactggttccaatcaaactcacgagtgataat
atatatggctatcaacagtggaaatctagttctctttcatattttcgttaccataatctt
cttggaatcattgatggaacagacactcgtcctgatcagcaacttcattctgctgagttt
tttaattggagtaacagagatcaaaaggttcttgagtggcttagaaacactctgtccata
gatctccaccaccgtgtcatggccggcgccgactcttcacaaacggtgtggagaaacatc
aagaaacacttcgagagtctccctcttgcttacatctataatctcaaaagtgaactagta
aatgtaaagaaagacacagccatgtcgatgaatgactatctgcaaaagatcttccatctg
gcgcaattgcttgcagatgccggtgctcgtgtggaagatggggacttattttatctacac
atcctgacgggactgccaaaggagcaccgtacaaggttagaaaactctaatccacgtagt
ttccaagaggtgaaacacttgttgttgaaacaggaagaggaaatatatctgctgaatgaa
cagcggagatatacaaatactgccagtaatcaagcgacgaagccgcctccaaatactgtt
tctggcagtgttgttgtctctcccaatttgcatcaaccttctctctctcatgataagggt
ggcggagaagaagagcatgcggtcggtatcgatctgggaacaacgtattcctgcgtggcc
gtgtggcagaaagatcatgtagaaaccattctgaatgattatggtaacaggaaaactgca
tcatatgttgcattcacaaacactgaggaggcgatgataggcgatgcggcatttaaccaa
gttgtgagaaacaccgccaactcgatctttgatacaaaacgattaattggaagaagattt
agtgaagattctgttcaaagtgatatgaagctttggccattcaaggtcactcaaggttcg
gatgacaggccaatgattgtggttacccgcaatggtggcgaagagaaacaaattactcct
gaagaaatcgcatccatgattctgaaaaagatgcgtaagattgctgagactcatctaggc
tcacctgtgaaaaatgcagtcatcactgtccctgcttacttcaacgattcccagcgtcag
gctataaaggaggctggagtggttgctggcctagatgtaaagtgtgttattgacgaacca
agtgctgctgcccttgcttatggccttcacaagaagaccggttggagtagcagcagaaat
gtgatgatatttgatttgggcggtggcagtttaggtgtctccttggttaccatgaatact
tcagggacatttcaagtcatggcaacgggtggtgatggtcaccttggcggcgaagacttc
gataacagaatggtcaattattgcgttgaggaattcaaaactaagagtaaattggacgtg
agcaaagacttcagagcgcttaggagattaaagaatcaatgtgagaaagcaaaaaggaga
ctcgcatttgagtctgactttgacattgaaattgatcatttgtgtgaggataaggatttc
aacataacatttacccgtgacatgtttgaacaaattaatatggatttattcatcaagtgt
atggagtcagtggagaagtgtttgagggatgctaacatggacccaagtaacgtcgatgat
gttcttcttgctggtggctcttctagaattccaatggtgcaacaactattacaacaggca
ttcaaagggaaggagctgtgcaagggcattgatctggatgaggcaatggcacatggtgct
gctgttcaagctgcaatctcctgtgggaatggaaaggggaagcttcaagactacattact
ctttcagatgtcactccttcgccaggggcaactcccttggcagatgcaactgataagacg
gcacggggccgcccacattcatggaccaacaccatttcttcgatatttggtagtagcaaa
tga

DBGET integrated database retrieval system