KEGG   Paenibacillus xylanexedens: BS614_01180Help
Entry
BS614_01180       CDS       T04676                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pxl  Paenibacillus xylanexedens
Pathway
pxl00564  Glycerophospholipid metabolism
pxl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BS614_01180
Enzymes [BR:pxl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BS614_01180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 3HCDH_N GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: APO42831
UniProt: A0A1L5LHG8
LinkDB All DBs
Position
complement(301299..302957)
Genome map
AA seq 552 aa AA seqDB search
MTETFSSAHRTEYLQSMANAHFDVLIIGGGITGAGIALDAASRGLKTALVEMQDFAAGTS
SRSTKLVHGGLRYLKQYEVKMVAEVGRERAVVYENGPHVTTPEPMLLPIYTAGTFGRFST
SIGLMVYDRLAGVKRSERRQMLNAGAVSDSEPLLRKQGLLGGGLYVEYRTDDARLTIEVM
KEAVKRGAQAVNYVKAKGFLKENGKITGIEAMDQIDGQTYTLKASKVINASGPWVDGLRE
LDGSRQGKTLQMTKGIHLVFDGERFPLRQAVYFDTPDGRMVFAVPRDGKTYVGTTDTVYQ
DDPAHPQISDADRDYVIDAVNGMFPDVHIGTEDVESGWAGVRPLIHEEGKNPSEISRKDE
VWVSESNLITIAGGKLTGYRKMAEMVVDLVARQMEQESGHSIGPCVTKKMPISGGDVGGS
AGFVSYAERKIKDGVALGLARPAAERLVRTYGSNVEALYERMPDPRTKSELHGMPQELLL
MLHYAIDEEMAATPSDFLVRRTGDLFFRIDEVRRYKAAVISYMAGRLNWSEEEEVKHTQE
LDQLLLEASGKI
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaacgttctcgtcagcacaccggaccgaatatttgcaaagcatggcgaatgca
cattttgacgtattaattattggcggtgggattacaggcgcagggattgcattggacgcg
gcttcccgtggattgaagacagcgcttgtagagatgcaggattttgcagcaggtacatcc
agtcgttcgaccaaacttgtccatggcggattacgttatttgaagcaatatgaagtgaag
atggttgctgaggtaggacgggagcgggctgtcgtttatgagaatgggccacatgtgacc
acaccggaaccgatgttgttaccgatctatacggctggcacgttcggccgcttcagtaca
tccattggactgatggtgtatgaccggctcgccggggtgaagcgcagtgaacggcgccaa
atgttgaatgccggagcggtgtcagatagtgaacctctgttacgcaaacaggggttgttg
ggtggtggactctatgtggagtaccggactgatgatgccaggctcaccattgaagttatg
aaagaagctgtcaaacgtggggcacaggccgtgaactacgttaaggcgaaaggtttcctg
aaggagaatggcaagattacaggtattgaagctatggatcagatcgatgggcagacctat
acgctaaaagcaagcaaggtgatcaacgcttccggtccatgggtggacggtctgcgggaa
ttggatggttcgcgccaggggaaaacgctgcagatgaccaaaggcattcatttggtcttt
gatggtgaacgattcccattaagacaggccgtctattttgatacaccagatggtcgaatg
gtgtttgctgtcccacgtgatggcaaaacctatgtaggtacaaccgacactgtatatcag
gatgatcctgcacacccgcaaatttccgacgcggatcgcgattatgtgattgatgcagtt
aatggcatgtttccagatgtacacattggtaccgaggacgtggaatccggatgggcgggt
gtacgtccactaattcatgaggaaggcaagaatccttccgaaatatcacgtaaagatgaa
gtctgggtatccgaatccaatctgattacgattgccgggggcaagttaactggataccgt
aaaatggccgagatggttgttgatctggtcgcacgccagatggagcaggagagtggacat
tccataggcccatgtgtaacgaagaagatgcccatctccggcggtgatgtagggggatcg
gctggatttgtatcgtatgcggagcgcaagatcaaggacggtgttgccctcgggcttgcc
cgacctgctgcggagcggctggttcgcacgtatggttccaatgtggaggcactgtatgag
cgaatgcccgatccacgcaccaagtccgagcttcatggcatgccacaggagttattgctt
atgctacattacgcgattgatgaagagatggctgcaaccccgtctgactttttggtacga
agaacaggtgatttattcttccgtattgatgaagttcgtcgctataaagcagcggttatc
tcgtatatggcaggtcgtttgaactggtctgaagaggaagaggttaaacatacacaggaa
ctggatcagctgttgctggaagcatccggcaaaatctaa

DBGET integrated database retrieval system