KEGG   Paenibacillus xylanexedens: BS614_03820Help
Entry
BS614_03820       CDS       T04676                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
pxl  Paenibacillus xylanexedens
Pathway
pxl00340  Histidine metabolism
pxl01100  Metabolic pathways
pxl01110  Biosynthesis of secondary metabolites
pxl01230  Biosynthesis of amino acids
Module
pxl_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BS614_03820
Enzymes [BR:pxl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BS614_03820
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BS614_03820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: APO43262
UniProt: A0A1L5LIP3
LinkDB All DBs
Position
880821..881555
Genome map
AA seq 244 aa AA seqDB search
MTKVSDEIKEQLSLEQVVEHIRWSEGLVPAIVQDVDTREVLMMAYMNRESLKLSLESGET
WFWSRSRQELWHKGATSGNVQTITSLKYDCDGDTLLVEVKPNGPACHTGAVTCFHNEIIG
LPEKSADKASDEASAASASTNSGSESRFEVLAELESVIAERERERPEGAYTTYLFDKGVD
KILKKIGEEASETIIAAKNKDNDELRLEVSDLMYHLLVLLQERKLPLGDIMSELSRRHER
PRRD
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaagtaagtgatgaaatcaaggaacagttgtccttggaacaggttgtggagcac
attcgttggagtgaaggattggttcctgccattgtgcaggatgtagatactcgggaagtc
ttgatgatggcttatatgaatcgcgaatctctgaagttgtcgcttgaatccggtgagacg
tggttctggtcacgctcgcgtcaggagttgtggcataaaggagcaacatctggcaacgtg
cagacgattacttccctaaaatatgattgtgacggcgataccttgttggttgaggtgaaa
ccgaacggtccggcttgccatacaggggcggtaacttgtttccataatgaaatcattggt
ttgccagagaaatcagcagacaaggcttcggatgaagcgagtgcggcatctgcttctaca
aattccggttccgaaagtcgctttgaggtattggctgaactggaatccgttattgcagag
cgtgaacgtgagcgtcctgagggtgcatatacaacgtatctgtttgataaaggtgtagac
aaaatactgaaaaaaatcggtgaagaagcgtccgagacaatcatcgccgccaaaaataaa
gataatgacgagcttcgtctggaagtcagtgacctgatgtatcacctgctcgtcctgtta
caagaacgcaagctgccgctgggcgacattatgtcagagctgagccgccgtcatgaacgg
cctcgccgcgattag

DBGET integrated database retrieval system