KEGG   Paenibacillus xylanexedens: BS614_03875Help
Entry
BS614_03875       CDS       T04676                                 

Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
pxl  Paenibacillus xylanexedens
Pathway
pxl00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BS614_03875
Enzymes [BR:pxl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     BS614_03875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox NAD_binding_8 FAD_binding_2 HI0933_like GIDA K_oxygenase Thi4 NAD_binding_7 DAO FAD_oxidored FAD_binding_3 FMO-like
Motif
Other DBs
NCBI-ProteinID: APO43273
UniProt: A0A1L5LIR2
LinkDB All DBs
Position
896069..897028
Genome map
AA seq 319 aa AA seqDB search
MSKYRTIVIGTGPAGLTAAIYLARANLKPLVIEGLQPGGQLTTTTEVENFPGFPQGIMGP
ELMDNMRKQAERFGAEFKNGWVEEVDFSKPPFKVKVGGIGELEAESIIISTGASARYLGI
PGEQENVGRGVSTCATCDGFFFRGKKIVVVGGGDSAMEEASFLTRFATDVTLVHRRDELR
ASKIMQDRARSNEKVKWALNRTPLEVVPEALGVKGLKVRNNETGQEELLEADGVFVAIGH
TPNTGFLGNAIALDEHGYVVVKPGTTETNIPGVFACGDVQDTKYRQAITAAGSGCMAAMD
CEKFLEGSIVHDWSETLDK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaatacagaacgattgtgatcggaacgggacctgcgggtctgacagcagcgata
tatctggctcgtgctaatctgaaaccactggttatcgaaggtcttcagccgggtggtcaa
ttgacgacgacaacggaagttgagaatttccccggtttcccgcaaggtatcatgggtccg
gaactgatggacaacatgcgtaagcaagctgaacgttttggagcggaattcaaaaacggt
tgggtggaagaggttgatttcagcaaaccgcccttcaaggtcaaagttggaggaatcggt
gaactggaagctgaatcgatcattatctccacaggtgcttccgctcgttatctcggtatt
ccgggcgagcaggaaaatgtgggacgtggtgtaagtacatgcgcgacatgtgacggcttc
ttcttccgaggcaaaaaaatcgtggtcgtgggcggtggagactccgcgatggaggaagcg
agtttcctgactcgttttgcaacagacgtgacattggttcaccgccgggatgaattacgt
gcatccaagattatgcaggatcgggctcgcagcaatgaaaaggtgaagtgggcgctgaac
cgtactccactcgaggtcgtaccagaagctttgggtgtcaaagggctgaaagtgcgcaac
aacgagacggggcaggaagagttgcttgaagcagatggcgtattcgttgccattggtcac
acaccgaatactggattcctgggtaatgcgattgcactggacgaacatggctatgttgtc
gttaaacccggaacaacggagaccaatattccaggtgtatttgcctgtggtgatgttcag
gatacgaagtatcgtcaagccattacggcagctggatcaggatgtatggccgcgatggat
tgtgagaagttccttgaaggaagcattgtccatgattggagcgagacgttggataaataa

DBGET integrated database retrieval system