KEGG   Paenibacillus xylanexedens: BS614_08735Help
Entry
BS614_08735       CDS       T04676                                 

Definition
(GenBank) hypothetical protein
Organism
pxl  Paenibacillus xylanexedens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen DUF4183
Motif
Other DBs
NCBI-ProteinID: APO44084
UniProt: A0A1L5LL55
LinkDB All DBs
Position
1995543..1996481
Genome map
AA seq 312 aa AA seqDB search
MARDKKVIALPRGVGSNPVCCEPAPLLAPLRQHELETVSLPGTQGVAGVQGPAGPHGGPG
QQGVPGAQGPVGPHGGLGQPGVPGAQGPAGPQGETGQRGVPGEQGPAGPQGESGQPGVPG
AQGPAGPQGEPGQPGIPGAQGPVGPQGESGQPGVPGAQGPVGPQGEPGQAGLPGAQGPAG
PQGEPGQPGTPGVQGPMGPPGEQGPPGTVPGIEIIPTANRYFYFPDTDLDLSASVVIPAT
EFTNDDGDSITEFAGVGLTSFNNLYINGIVQPGNSYSVSAERLFFSSQSGVIFAGTPITI
EIIIITANIING
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtgacaaaaaagtcattgcattaccgagaggggtaggcagcaacccggtatgt
tgtgagcctgcccccctgctcgctccgttgagacaacatgaattggagactgtgagtctc
cctggaacgcaaggtgtggcaggtgtccaaggccccgcaggccctcacggcgggccgggt
caacaaggggttcccggagcgcagggtcctgttggtcctcacggtgggctgggtcaaccg
ggagttccgggagcgcaaggcccggcaggtcctcagggtgaaacgggtcaacggggagtt
cccggagagcaaggccccgcaggccctcaaggtgaatcgggtcaaccgggagttccggga
gcgcaaggcccggcaggtcctcaaggtgagccgggtcaaccgggaattccgggagcgcaa
ggtccggttggtcctcaaggtgaatcgggtcaaccgggagttcccggagcgcaaggtcct
gttggtcctcagggtgaaccgggtcaagcaggacttcccggagcgcagggtccggcaggt
cctcaaggtgagccaggtcaaccgggaactcccggagtccaaggaccaatgggtccccca
ggtgagcaaggtccgccgggcacggtacccggaattgaaatcattcctacggcaaaccgt
tacttctattttccggataccgatctggatttgtcggcctcggttgtaattcctgccaca
gaattcacaaatgacgatggcgacagcataaccgaatttgccggggttggacttactagt
ttcaacaatctttatataaacgggattgtacaaccaggaaactcatacagtgtaagtgcg
gagaggttgtttttttcgtcacaaagcggtgtgatctttgcagggacacctatcactata
gagataattataataacagccaatatcataaatggttaa

DBGET integrated database retrieval system