KEGG   Paenibacillus xylanexedens: BS614_10440Help
Entry
BS614_10440       CDS       T04676                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pxl  Paenibacillus xylanexedens
Pathway
pxl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BS614_10440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pxl03400]
    BS614_10440
Enzymes [BR:pxl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BS614_10440
DNA repair and recombination proteins [BR:pxl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BS614_10440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: APO44381
UniProt: A0A1L5LLV1
LinkDB All DBs
Position
complement(2394195..2395145)
Genome map
AA seq 316 aa AA seqDB search
MFKPLIPFEPISRDTLPTGPQWIAQIKWDGVRMLAYEDGQELRLVNRRLHDRTAQYPELV
TPRNLCSGSSYILDGEVIALDPDTGKPSFYHVLRRDRMSRPEGIAQAIHQIPVTYMVFDI
LFYEGKWVTDQPLADRQRLLHEILNTAPHVQEVTNTLDAASLLTVMRQHQMEGIVCKDLT
SSYGIQGKDQRWQKVKIMHDVYAMIGGVTYRSGIVNAVAVGVYNGPNFVYIGHVGTGKLN
SNTWRELTHQVEPLIRQDRPFHNVPERSAETTWVEPRIGVKVQYMELTHHNTLRHPSIQT
FADVTREDCLANQLLQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaccgttgattccgttcgagcctatctccagagatactttgcccacagggccg
caatggattgcccagatcaagtgggatggagtccgcatgcttgcctatgaggacgggcag
gagctgcgcctggtgaatcgcagattacatgatcgaactgcacagtatcccgagttggta
acaccacgcaatttatgttcaggctcctcctatatcttggatggagaagttattgcgctg
gacccggataccggaaaaccttcgttttatcatgttcttcggcgggatcggatgagcaga
cccgaaggtatcgcccaagccatacatcagattccggtcacatatatggtatttgatatc
ctgttctatgaggggaaatgggtgacggatcagcctttggcagatcgacagcgcctgttg
cacgagatccttaacaccgctccccatgttcaggaggtcaccaatacacttgatgccgct
tccctgcttacagtcatgagacaacatcagatggaaggcattgtctgcaaggatctcacc
agcagttatggcatacagggcaaggaccagcgctggcagaaggtcaaaatcatgcatgat
gtatatgccatgatcgggggagtcacgtaccggagcggtattgtgaatgccgtcgcggtc
ggagtatataatgggccaaactttgtctatattggtcatgtcgggactggcaagctgaac
tccaatacgtggcgggaactcacacatcaagtcgagcctctgatcaggcaggacagaccg
ttccataatgtacccgagcgcagtgcggagaccacctgggtggaaccacgaataggagtc
aaagtgcaatatatggagctgactcatcataacactctacgccatcccagtattcagacc
ttcgcggatgtaacccgtgaggattgtctggcgaaccagcttcttcaatga

DBGET integrated database retrieval system